Clone Name | rbah63o18 |
---|---|
Clone Library Name | barley_pub |
>CBLC_HUMAN (Q9ULV8) Signal transduction protein CBL-C (SH3-binding protein| CBL-C) (CBL-3) (RING finger protein 57) Length = 474 Score = 33.9 bits (76), Expect = 0.21 Identities = 15/32 (46%), Positives = 19/32 (59%) Frame = -1 Query: 416 TSEDEGNAGQRYHRFLDQGQTPLCCPSSPTRP 321 T+ED GN+ + R L+ GQ PL P P RP Sbjct: 409 TAEDSGNSSDQEGRELELGQVPLSAPPLPPRP 440
>ZCHC4_MOUSE (Q8BKW4) Zinc finger CCHC domain-containing protein 4| Length = 512 Score = 30.0 bits (66), Expect = 3.1 Identities = 17/46 (36%), Positives = 24/46 (52%) Frame = -1 Query: 419 ETSEDEGNAGQRYHRFLDQGQTPLCCPSSPTRPAALYIHVPRLSFI 282 E+ E +G+AG+R + PS+PT PA L H P L F+ Sbjct: 9 ESLEGDGDAGRR------ASGVEVALPSNPTAPAPLCPHGPTLLFV 48
>AKR1_GIBZE (Q4I8B6) Palmitoyltransferase AKR1 (EC 2.3.1.-) (Ankyrin| repeat-containing protein AKR1) Length = 702 Score = 29.6 bits (65), Expect = 4.0 Identities = 23/73 (31%), Positives = 37/73 (50%), Gaps = 2/73 (2%) Frame = -1 Query: 446 KGETGEANGETSEDEGNAGQRYHRFLDQ-GQTPLCCPSSPTRPAALYIHVPRLSFITKF- 273 K +TG+ T++ E N +HR L + G P+ P P A Y + SF+T+F Sbjct: 224 KTQTGKTPSVTAK-ELNTEVAWHRALTECGFDEDGHPAVPPWPGASYFLKDKRSFVTRFL 282 Query: 272 YFNRYMIVWCCSV 234 +F +++VW V Sbjct: 283 FFWPFVLVWAMLV 295
>SULF1_CAEEL (Q21376) Putative extracellular sulfatase Sulf-1 homolog precursor| (EC 3.1.6.-) (CeSulf-1) Length = 709 Score = 28.5 bits (62), Expect = 8.9 Identities = 10/18 (55%), Positives = 12/18 (66%) Frame = -1 Query: 356 TPLCCPSSPTRPAALYIH 303 TP+CCPS T LY+H Sbjct: 76 TPICCPSRSTILTGLYVH 93
>PYR1_EMENI (O93937) Protein pyrABCN [Includes: Glutamine-dependent| carbamoyl-phosphate (EC 6.3.5.5); Aspartate carbamoyltransferase (EC 2.1.3.2)] Length = 2275 Score = 28.5 bits (62), Expect = 8.9 Identities = 11/14 (78%), Positives = 12/14 (85%) Frame = +2 Query: 344 NIGVFVPGLGSGDS 385 N+G FVPGLGS DS Sbjct: 1552 NVGAFVPGLGSADS 1565 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 64,272,837 Number of Sequences: 219361 Number of extensions: 1275519 Number of successful extensions: 3239 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 3157 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3238 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3014947676 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)