Clone Name | rbart52g04 |
---|---|
Clone Library Name | barley_pub |
>FOXE3_MOUSE (Q9QY14) Forkhead box protein E3| Length = 288 Score = 30.8 bits (68), Expect = 0.89 Identities = 21/47 (44%), Positives = 22/47 (46%) Frame = +3 Query: 180 PLPPTFREAPFPVPINRHPRPRREPEAVIQRLIRQTSDRQWQPDIPG 320 P PP F APFP P P P P A RL R S QP+ PG Sbjct: 170 PPPPPFPYAPFPPP----PAPASAPPA---RLFRLDSLLGLQPEPPG 209
>WSP1_SCHPO (O36027) Wiskott-Aldrich syndrome homolog protein 1| Length = 574 Score = 30.4 bits (67), Expect = 1.2 Identities = 14/33 (42%), Positives = 18/33 (54%) Frame = +3 Query: 156 KRHSGSSIPLPPTFREAPFPVPINRHPRPRREP 254 + ++ SIPLPP R AP P P P R+P Sbjct: 344 RSNAAGSIPLPPQGRSAPPPPPPRSAPSTGRQP 376
>CBL_MOUSE (P22682) E3 ubiquitin-protein ligase CBL (EC 6.3.2.-) (Signal| transduction protein CBL) (Proto-oncogene c-CBL) (Casitas B-lineage lymphoma proto-oncogene) Length = 913 Score = 30.4 bits (67), Expect = 1.2 Identities = 14/37 (37%), Positives = 19/37 (51%), Gaps = 6/37 (16%) Frame = +3 Query: 162 HSGSSIPLPPTFREAPFPVPINR------HPRPRREP 254 H +P+PPT R+ P P P +R RP+R P Sbjct: 526 HKDKPLPIPPTLRDLPPPPPPDRPYSVGAETRPQRRP 562
>CBL_HUMAN (P22681) E3 ubiquitin-protein ligase CBL (EC 6.3.2.-) (Signal| transduction protein CBL) (Proto-oncogene c-CBL) (Casitas B-lineage lymphoma proto-oncogene) (RING finger protein 55) Length = 906 Score = 30.0 bits (66), Expect = 1.5 Identities = 14/37 (37%), Positives = 19/37 (51%), Gaps = 6/37 (16%) Frame = +3 Query: 162 HSGSSIPLPPTFREAPFPVPINR------HPRPRREP 254 H +P+PPT R+ P P P +R RP+R P Sbjct: 528 HKDKPLPVPPTLRDLPPPPPPDRPYSVGAESRPQRRP 564
>XDH_CHICK (P47990) Xanthine dehydrogenase/oxidase [Includes: Xanthine| dehydrogenase (EC 1.17.1.4) (XD); Xanthine oxidase (EC 1.17.3.2) (XO) (Xanthine oxidoreductase)] Length = 1358 Score = 29.3 bits (64), Expect = 2.6 Identities = 14/29 (48%), Positives = 16/29 (55%) Frame = +2 Query: 20 QHGPTGPCLDVPPRQSSNTDLKFHDPIPS 106 Q+GP C VPP S T+L DPI S Sbjct: 557 QNGPNNLCEPVPPNYISATELFHKDPIAS 585
>Y2082_MYCTU (Q10690) Hypothetical protein Rv2082| Length = 721 Score = 29.3 bits (64), Expect = 2.6 Identities = 21/48 (43%), Positives = 24/48 (50%), Gaps = 1/48 (2%) Frame = +2 Query: 182 SSPNLQGGAIS-CANKSTPSTTTGTRSCNPTPHPPNLRSTMAARHTGS 322 SSP G +S NKST TT + NPT P L S AA TG+ Sbjct: 457 SSPAAGGSLMSPVVNKSTAPATTQAQPSNPT---PPLASATAAATTGA 501
>HUWE1_MOUSE (Q7TMY8) HECT, UBA and WWE domain-containing protein 1 (EC 6.3.2.-)| (E3 ubiquitin protein ligase URE-B1) (E3Histone) Length = 4377 Score = 29.3 bits (64), Expect = 2.6 Identities = 17/45 (37%), Positives = 23/45 (51%) Frame = +2 Query: 149 LPKKTFR*QYTSSPNLQGGAISCANKSTPSTTTGTRSCNPTPHPP 283 LP+ T+S N + +N ST +TTT T + PTP PP Sbjct: 3465 LPENKVSEVQTNSSNSGSSTAATSNTSTTTTTTTTATA-PTPTPP 3508
>TUS1_YEAST (Q06412) Rho1 guanine nucleotide exchange factor TUS1 (TOR unique| function suppressor protein 1) Length = 1307 Score = 29.3 bits (64), Expect = 2.6 Identities = 16/45 (35%), Positives = 25/45 (55%) Frame = +2 Query: 176 YTSSPNLQGGAISCANKSTPSTTTGTRSCNPTPHPPNLRSTMAAR 310 +TS + +G S +++STP +T + P P PP L ST + R Sbjct: 76 FTSKHSARGNGTS-SSESTPKSTKYVKERRPPPPPPLLYSTESIR 119
>SRRM1_PONPY (Q5R5Q2) Serine/arginine repetitive matrix protein 1| Length = 917 Score = 28.9 bits (63), Expect = 3.4 Identities = 13/31 (41%), Positives = 15/31 (48%) Frame = +3 Query: 180 PLPPTFREAPFPVPINRHPRPRREPEAVIQR 272 P PP R P P P R P PRR + +R Sbjct: 587 PTPPPRRRTPSPPPRRRSPSPRRYSPPIQRR 617
>AB1IP_HUMAN (Q7Z5R6) Amyloid beta A4 precursor protein-binding family B member| 1-interacting protein (APBB1-interacting protein 1) (Rap1-GTP-interacting adapter molecule) (RIAM) (Proline-rich EVH1 ligand 1) (PREL-1) (Proline-rich protein 73) (Retinoic ac Length = 666 Score = 28.9 bits (63), Expect = 3.4 Identities = 21/54 (38%), Positives = 25/54 (46%) Frame = +3 Query: 165 SGSSIPLPPTFREAPFPVPINRHPRPRREPEAVIQRLIRQTSDRQWQPDIPGVA 326 +GS +P PP AP P P+ P R P AV +R RQ P PG A Sbjct: 594 AGSELPPPPPPPPAPAPAPV---PDSARPPPAVAKR-PPVPPKRQENPGHPGGA 643
>FOXE1_HUMAN (O00358) Forkhead box protein E1 (Thyroid transcription factor 2)| (TTF-2) (Forkhead-related protein FKHL15) Length = 376 Score = 28.9 bits (63), Expect = 3.4 Identities = 16/57 (28%), Positives = 28/57 (49%) Frame = +2 Query: 149 LPKKTFR*QYTSSPNLQGGAISCANKSTPSTTTGTRSCNPTPHPPNLRSTMAARHTG 319 +P++ + +P+ GG+ + A+ P+TTTG + T P S AA + G Sbjct: 230 VPERPLSPELGPAPSGPGGSCAFASAGAPATTTGYQPAGCTGARPANPSAYAAAYAG 286
>SRRM1_HUMAN (Q8IYB3) Serine/arginine repetitive matrix protein 1| (Ser/Arg-related nuclear matrix protein) (SR-related nuclear matrix protein of 160 kDa) (SRm160) Length = 904 Score = 28.9 bits (63), Expect = 3.4 Identities = 13/31 (41%), Positives = 15/31 (48%) Frame = +3 Query: 180 PLPPTFREAPFPVPINRHPRPRREPEAVIQR 272 P PP R P P P R P PRR + +R Sbjct: 573 PTPPPRRRTPSPPPRRRSPSPRRYSPPIQRR 603
>SRRM1_MOUSE (Q52KI8) Serine/arginine repetitive matrix protein 1| (Plenty-of-prolines 101) Length = 946 Score = 28.9 bits (63), Expect = 3.4 Identities = 13/31 (41%), Positives = 15/31 (48%) Frame = +3 Query: 180 PLPPTFREAPFPVPINRHPRPRREPEAVIQR 272 P PP R P P P R P PRR + +R Sbjct: 592 PTPPPRRRTPSPPPRRRSPSPRRYSPPIQRR 622
>DRS1_YARLI (Q6CEB8) ATP-dependent RNA helicase DRS1 (EC 3.6.1.-)| Length = 753 Score = 28.1 bits (61), Expect = 5.7 Identities = 13/48 (27%), Positives = 28/48 (58%) Frame = -2 Query: 196 KVGGRGILLPECLFRQEEEKSSLESRYTNIRWNRVMKFEICVGALPRR 53 K+ +G ++ E L ++EEK+ L++ + ++K+E + + PRR Sbjct: 643 KIEEKGDIVNEILAEEKEEKAMLQAEMEVRKGENLLKYEKEIASRPRR 690
>AROA_CHLPN (Q9Z6M0) 3-phosphoshikimate 1-carboxyvinyltransferase (EC 2.5.1.19)| (5-enolpyruvylshikimate-3-phosphate synthase) (EPSP synthase) (EPSPS) Length = 445 Score = 28.1 bits (61), Expect = 5.7 Identities = 11/31 (35%), Positives = 20/31 (64%) Frame = +1 Query: 100 SIVYSYIYFPDCSSLLLA*KDIQVAVYLFPQ 192 SI+Y+Y+ PD +++ A K + ++ FPQ Sbjct: 38 SIIYNYLDSPDTEAMICACKQMGASIKKFPQ 68
>TCF8_HUMAN (P37275) Transcription factor 8 (NIL-2-A zinc finger protein)| (Negative regulator of IL2) Length = 1124 Score = 28.1 bits (61), Expect = 5.7 Identities = 12/21 (57%), Positives = 15/21 (71%) Frame = +2 Query: 236 STTTGTRSCNPTPHPPNLRST 298 STT G+RS P+P P NL S+ Sbjct: 693 STTNGSRSSTPSPSPLNLSSS 713
>VPS72_HUMAN (Q15906) Vacuolar protein sorting protein 72 homolog (Protein YL-1)| (Transcription factor-like 1) Length = 364 Score = 27.7 bits (60), Expect = 7.5 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +2 Query: 2 PEKIISQHGPTGPCLDVPPRQSSNTDLKFHDPIPS 106 P II+ H T P + P + N D++ DP PS Sbjct: 208 PGPIITYHSVTVPLVGEPGPKEENVDIEGLDPAPS 242
>IRF2_MOUSE (P23906) Interferon regulatory factor 2 (IRF-2)| Length = 349 Score = 27.7 bits (60), Expect = 7.5 Identities = 18/48 (37%), Positives = 24/48 (50%), Gaps = 8/48 (16%) Frame = +3 Query: 174 SIPLP-----PTFREAPFPVPINRHP---RPRREPEAVIQRLIRQTSD 293 S P+P P F + P P P+ P RP RE A + I++TSD Sbjct: 296 SCPMPYNSSWPPFTDLPLPAPVTPTPSSSRPDRETRASV---IKKTSD 340
>BCAS1_MOUSE (Q80YN3) Breast carcinoma amplified sequence 1 homolog (Novel| amplified in breast cancer 1 homolog) Length = 633 Score = 27.7 bits (60), Expect = 7.5 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = +2 Query: 179 TSSPNLQGGAISCANKSTPSTTTGTRSCNPTPHP 280 T+S NL+ + + T T T+SC+P P P Sbjct: 362 TTSANLKSDKANFTPQETRGKTKATKSCSPPPPP 395
>SPT21_YEAST (P35209) Protein SPT21| Length = 758 Score = 27.7 bits (60), Expect = 7.5 Identities = 17/59 (28%), Positives = 25/59 (42%) Frame = +2 Query: 119 STFQTALLFFLPKKTFR*QYTSSPNLQGGAISCANKSTPSTTTGTRSCNPTPHPPNLRS 295 S+ +A L F PK + N + + +T S T G R NP P P +R+ Sbjct: 216 SSLPSATLPFTPKSQSLFKTNQIKNSRNARTTITINNTNSGTVGRRQTNPMPAPKAVRT 274
>EPHA7_RAT (P54759) Ephrin type-A receptor 7 precursor (EC 2.7.10.1)| (Tyrosine-protein kinase receptor EHK-3) (EPH homology kinase 3) Length = 998 Score = 27.7 bits (60), Expect = 7.5 Identities = 15/44 (34%), Positives = 22/44 (50%) Frame = -2 Query: 145 EEKSSLESRYTNIRWNRVMKFEICVGALPRRNIQTRSSWAVLGN 14 EE S L+ YT IR +++C P +N R++W GN Sbjct: 56 EEISGLDENYTPIR-----TYQVCQVMEPNQNNWLRTNWISKGN 94
>EPHA7_MOUSE (Q61772) Ephrin type-A receptor 7 precursor (EC 2.7.10.1)| (Tyrosine-protein kinase receptor EHK-3) (EPH homology kinase 3) (Embryonic brain kinase) (EBK) (Developmental kinase 1) (MDK-1) Length = 998 Score = 27.7 bits (60), Expect = 7.5 Identities = 15/44 (34%), Positives = 22/44 (50%) Frame = -2 Query: 145 EEKSSLESRYTNIRWNRVMKFEICVGALPRRNIQTRSSWAVLGN 14 EE S L+ YT IR +++C P +N R++W GN Sbjct: 56 EEISGLDENYTPIR-----TYQVCQVMEPNQNNWLRTNWISKGN 94
>EPHA7_HUMAN (Q15375) Ephrin type-A receptor 7 precursor (EC 2.7.10.1)| (Tyrosine-protein kinase receptor EHK-3) (EPH homology kinase 3) (Receptor protein-tyrosine kinase HEK11) Length = 998 Score = 27.7 bits (60), Expect = 7.5 Identities = 15/44 (34%), Positives = 22/44 (50%) Frame = -2 Query: 145 EEKSSLESRYTNIRWNRVMKFEICVGALPRRNIQTRSSWAVLGN 14 EE S L+ YT IR +++C P +N R++W GN Sbjct: 56 EEISGLDENYTPIR-----TYQVCQVMEPNQNNWLRTNWISKGN 94
>VSM1_TRYBB (P26331) Variant surface glycoprotein MITAT 1.1 precursor (VSG)| Length = 492 Score = 27.7 bits (60), Expect = 7.5 Identities = 13/25 (52%), Positives = 15/25 (60%) Frame = +2 Query: 179 TSSPNLQGGAISCANKSTPSTTTGT 253 T PNLQ G AN P+T+TGT Sbjct: 197 TGYPNLQHGGGGTANTFQPTTSTGT 221
>GRIN1_MOUSE (Q3UNH4) G protein-regulated inducer of neurite outgrowth 1 (GRIN1)| Length = 932 Score = 27.7 bits (60), Expect = 7.5 Identities = 13/50 (26%), Positives = 25/50 (50%) Frame = +2 Query: 173 QYTSSPNLQGGAISCANKSTPSTTTGTRSCNPTPHPPNLRSTMAARHTGS 322 ++TSS GA SC+ + S + +C+P P P + + ++G+ Sbjct: 28 RHTSSSGAAEGA-SCSERPAGSLACPSPNCSPLPETPRAHGALTSDNSGT 76
>KIF1C_HUMAN (O43896) Kinesin-like protein KIF1C| Length = 1103 Score = 27.7 bits (60), Expect = 7.5 Identities = 18/52 (34%), Positives = 23/52 (44%), Gaps = 8/52 (15%) Frame = +3 Query: 159 RHSGSSIPLPPTFR--------EAPFPVPINRHPRPRREPEAVIQRLIRQTS 290 R +GS+ P P F+ + P P P R P PR P R+ RQ S Sbjct: 1041 RGAGSAQPEPQHFQPKKHNSYPQPPQPYPAQRPPGPRYPPYTTPPRMRRQRS 1092
>COPB2_CAEEL (Q20168) Probable coatomer subunit beta' (Beta'-coat protein)| (Beta'-COP) Length = 1000 Score = 27.3 bits (59), Expect = 9.8 Identities = 18/50 (36%), Positives = 23/50 (46%), Gaps = 4/50 (8%) Frame = +3 Query: 180 PLPPTFREAPFPV----PINRHPRPRREPEAVIQRLIRQTSDRQWQPDIP 317 P PP+ P PV PI R P P REPE + + D Q + +P Sbjct: 873 PPPPSVARQPSPVRQPSPI-REPSPIREPEPEEEEEQEEFDDDQQEVHVP 921
>PALA_NEUCR (Q7S532) pH-response regulator protein palA/rim-20| Length = 886 Score = 27.3 bits (59), Expect = 9.8 Identities = 15/31 (48%), Positives = 17/31 (54%) Frame = -2 Query: 187 GRGILLPECLFRQEEEKSSLESRYTNIRWNR 95 GR +LL E EEE S L +Y RWNR Sbjct: 497 GRSLLLAE-----EEEDSRLRLKYGTERWNR 522
>CLFB_STAAR (Q6GDH2) Clumping factor B precursor (Fibrinogen-binding protein B)| (Fibrinogen receptor B) Length = 873 Score = 27.3 bits (59), Expect = 9.8 Identities = 13/43 (30%), Positives = 23/43 (53%) Frame = +2 Query: 179 TSSPNLQGGAISCANKSTPSTTTGTRSCNPTPHPPNLRSTMAA 307 T+S N+ A + + +++ +TTT S N TP P ++ A Sbjct: 88 TNSANVDSTAKTMSTQTSNTTTTEPASTNETPQPTAIKDQATA 130
>AREA_PENRO (O13508) Nitrogen regulatory protein areA (Nitrogen regulator nmc)| Length = 860 Score = 27.3 bits (59), Expect = 9.8 Identities = 12/27 (44%), Positives = 16/27 (59%) Frame = +3 Query: 162 HSGSSIPLPPTFREAPFPVPINRHPRP 242 HSGS++ PPT + F VP +H P Sbjct: 440 HSGSAVTGPPTTHVSGFSVPPPQHINP 466
>POLN_EEEV1 (Q306W6) Nonstructural polyprotein (Polyprotein nsP1234) (P1234)| [Contains: P123; P123'; mRNA capping enzyme nsP1 (EC 2.1.1.-) (EC 2.7.7.-) (Nonstructural protein 1); Protease/triphosphatase/NTPase/helicase nsP2 (EC 3.4.22.-) (EC 3.1.3.33) (EC Length = 2470 Score = 27.3 bits (59), Expect = 9.8 Identities = 16/33 (48%), Positives = 19/33 (57%), Gaps = 7/33 (21%) Frame = +3 Query: 195 FREAPF-------PVPINRHPRPRREPEAVIQR 272 F++APF P+P PR RREPE IQR Sbjct: 1784 FKQAPFQFLSDIRPIPA---PRRRREPETDIQR 1813
>RDRP_PEAMV (P29154) RNA-directed RNA polymerase (EC 2.7.7.48)| Length = 599 Score = 27.3 bits (59), Expect = 9.8 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = +2 Query: 233 PSTTTGTRSCNPTPHPPNLRST 298 PS+ TG +SC +PH P + T Sbjct: 89 PSSGTGRKSCESSPHRPTTKIT 110 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 59,015,660 Number of Sequences: 219361 Number of extensions: 1307651 Number of successful extensions: 4758 Number of sequences better than 10.0: 32 Number of HSP's better than 10.0 without gapping: 4359 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4743 length of database: 80,573,946 effective HSP length: 84 effective length of database: 62,147,622 effective search space used: 1491542928 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)