ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | basd3k02 |
|---|---|
| Clone Library Name | barley_pub |
>ESM1_DROME (O97176) Enhancer of split M1 protein precursor (E(spl)m1)| Length = 156 Score = 32.0 bits (71), Expect = 1.4 Identities = 16/41 (39%), Positives = 22/41 (53%) Frame = -2 Query: 588 ACGTSCPVITKRIKA*PISGSDGHSFAHFKKSLDLHNRWCR 466 AC T CP I K P+ G+DG +F F + +L + CR Sbjct: 28 ACPTFCPSIYK-----PVCGTDGQNFKEFASTCNLLSHNCR 63
>RPOC2_WHEAT (Q9XPS9) DNA-directed RNA polymerase beta'' chain (EC 2.7.7.6)| (PEP) (Plastid-encoded RNA polymerase beta'' subunit) (RNA polymerase beta'' subunit) Length = 1479 Score = 29.6 bits (65), Expect = 6.7 Identities = 22/57 (38%), Positives = 30/57 (52%), Gaps = 4/57 (7%) Frame = +3 Query: 306 SLKAQDSFDEAKFLV-ETHIMPASSIARILADSFL---KGLLAAHRGRLSGLPKRRR 464 SLK Q D F++ E HI+P SS +IL +S + L R RL GL + +R Sbjct: 767 SLKYQKEVDRFFFILQELHILPRSSSLKILDNSIIGVDTQLTKNTRSRLGGLVRVKR 823
>NRF6_CAEEL (Q09225) Nose resistant to fluoxetine protein 6 precursor (Protein| nrf-6) Length = 822 Score = 29.3 bits (64), Expect = 8.8 Identities = 13/47 (27%), Positives = 26/47 (55%) Frame = +2 Query: 125 KWQQYD*SITGYGEISREMWRGARTSSY*ENNSGCANCKNTGTPIFR 265 K + +D S+ G++ W G +++ E + C++CK TP+F+ Sbjct: 101 KLKSFDISMACVGDMMHLAWTGVEYATHVEEHKNCSDCK--CTPLFQ 145
>RPOC2_ORYSA (P12093) DNA-directed RNA polymerase beta'' chain (EC 2.7.7.6)| (PEP) (Plastid-encoded RNA polymerase beta'' subunit) (RNA polymerase beta'' subunit) Length = 1513 Score = 29.3 bits (64), Expect = 8.8 Identities = 21/57 (36%), Positives = 30/57 (52%), Gaps = 4/57 (7%) Frame = +3 Query: 306 SLKAQDSFDEAKFLV-ETHIMPASSIARILADSFL---KGLLAAHRGRLSGLPKRRR 464 SLK Q D F++ E HI+P SS ++L +S + L R RL GL + +R Sbjct: 785 SLKYQKEVDRFFFILQELHILPRSSSLKVLDNSIIGVDTQLTKNTRSRLGGLVRVKR 841
>RPOC2_ORYNI (Q6ENI2) DNA-directed RNA polymerase beta'' chain (EC 2.7.7.6)| (PEP) (Plastid-encoded RNA polymerase beta'' subunit) (RNA polymerase beta'' subunit) Length = 1513 Score = 29.3 bits (64), Expect = 8.8 Identities = 21/57 (36%), Positives = 30/57 (52%), Gaps = 4/57 (7%) Frame = +3 Query: 306 SLKAQDSFDEAKFLV-ETHIMPASSIARILADSFL---KGLLAAHRGRLSGLPKRRR 464 SLK Q D F++ E HI+P SS ++L +S + L R RL GL + +R Sbjct: 785 SLKYQKEVDRFFFILQELHILPRSSSLKVLDNSIIGVDTQLTKNTRSRLGGLVRVKR 841
>RPOC2_SACOF (Q6ENX1) DNA-directed RNA polymerase beta'' chain (EC 2.7.7.6)| (PEP) (Plastid-encoded RNA polymerase beta'' subunit) (RNA polymerase beta'' subunit) Length = 1534 Score = 29.3 bits (64), Expect = 8.8 Identities = 21/57 (36%), Positives = 30/57 (52%), Gaps = 4/57 (7%) Frame = +3 Query: 306 SLKAQDSFDEAKFLV-ETHIMPASSIARILADSFL---KGLLAAHRGRLSGLPKRRR 464 SLK Q D F++ E HI+P SS ++L +S + L R RL GL + +R Sbjct: 811 SLKYQKEVDRFFFILQELHILPRSSSLKVLDNSIIGVDTQLTKNTRSRLGGLVRVKR 867
>RPOC2_SACHY (Q6L3A5) DNA-directed RNA polymerase beta'' chain (EC 2.7.7.6)| (PEP) (Plastid-encoded RNA polymerase beta'' subunit) (RNA polymerase beta'' subunit) Length = 1534 Score = 29.3 bits (64), Expect = 8.8 Identities = 21/57 (36%), Positives = 30/57 (52%), Gaps = 4/57 (7%) Frame = +3 Query: 306 SLKAQDSFDEAKFLV-ETHIMPASSIARILADSFL---KGLLAAHRGRLSGLPKRRR 464 SLK Q D F++ E HI+P SS ++L +S + L R RL GL + +R Sbjct: 811 SLKYQKEVDRFFFILQELHILPRSSSLKVLDNSIIGVDTQLTKNTRSRLGGLVRVKR 867
>RPOC2_MAIZE (P16025) DNA-directed RNA polymerase beta'' chain (EC 2.7.7.6)| (PEP) (Plastid-encoded RNA polymerase beta'' subunit) (RNA polymerase beta'' subunit) Length = 1527 Score = 29.3 bits (64), Expect = 8.8 Identities = 21/57 (36%), Positives = 30/57 (52%), Gaps = 4/57 (7%) Frame = +3 Query: 306 SLKAQDSFDEAKFLV-ETHIMPASSIARILADSFL---KGLLAAHRGRLSGLPKRRR 464 SLK Q D F++ E HI+P SS ++L +S + L R RL GL + +R Sbjct: 804 SLKYQKEVDRFFFILQELHILPRSSSLKVLDNSIIGVDTQLTKNTRSRLGGLVRVKR 860 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 86,299,277 Number of Sequences: 219361 Number of extensions: 1776002 Number of successful extensions: 4345 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 4206 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4345 length of database: 80,573,946 effective HSP length: 106 effective length of database: 57,321,680 effective search space used: 5101629520 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
