Clone Name | basd3j15 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | Y1003_ARCFU (O29259) Hypothetical protein AF1003 | 28 | 9.1 |
---|
>Y1003_ARCFU (O29259) Hypothetical protein AF1003| Length = 211 Score = 27.7 bits (60), Expect = 9.1 Identities = 13/32 (40%), Positives = 20/32 (62%), Gaps = 4/32 (12%) Frame = -3 Query: 125 LVRCFSSPGCLYACSWIQQAV*KV----DLFG 42 +VR +S PG +Y C +++AV + DLFG Sbjct: 100 IVRSYSPPGRIYTCKKLREAVESILSDSDLFG 131 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 18,296,612 Number of Sequences: 219361 Number of extensions: 207246 Number of successful extensions: 404 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 401 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 404 length of database: 80,573,946 effective HSP length: 22 effective length of database: 75,748,004 effective search space used: 1817952096 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)