Clone Name | basd3j03 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | GPA5_CAEEL (Q20701) Guanine nucleotide-binding protein alpha-5 s... | 28 | 6.7 | 2 | GPA5_CAEBR (Q619V5) Guanine nucleotide-binding protein alpha-5 s... | 28 | 6.7 | 3 | POLG_HCVH (P27958) Genome polyprotein [Contains: Core protein p2... | 28 | 8.7 |
---|
>GPA5_CAEEL (Q20701) Guanine nucleotide-binding protein alpha-5 subunit| Length = 385 Score = 28.1 bits (61), Expect = 6.7 Identities = 16/40 (40%), Positives = 25/40 (62%), Gaps = 1/40 (2%) Frame = -1 Query: 163 SDFIRTIETLMHNLHSTLGLHH-SNGKTRYILFLIRNGKQ 47 S+++ T E L+H +TLG+H S T++I+ LI G Q Sbjct: 164 SNYVPTAEDLIHMRQTTLGVHEISFDYTKHIIRLIDVGGQ 203
>GPA5_CAEBR (Q619V5) Guanine nucleotide-binding protein alpha-5 subunit| Length = 385 Score = 28.1 bits (61), Expect = 6.7 Identities = 11/31 (35%), Positives = 20/31 (64%) Frame = -1 Query: 193 FFFWIRNHPVSDFIRTIETLMHNLHSTLGLH 101 FF + +S+++ T+E L+H +TLG+H Sbjct: 154 FFPHLERIAISEYMPTVEDLIHMRQTTLGVH 184
>POLG_HCVH (P27958) Genome polyprotein [Contains: Core protein p21 (Capsid| protein C) (p21); Core protein p19; Envelope glycoprotein E1 (gp32) (gp35); Envelope glycoprotein E2 (NS1) (gp68) (gp70); p7; Protease NS2-3 (EC 3.4.22.-) (p23); Serine protease/NT Length = 3010 Score = 27.7 bits (60), Expect = 8.7 Identities = 14/37 (37%), Positives = 22/37 (59%) Frame = -1 Query: 118 STLGLHHSNGKTRYILFLIRNGKQDRTPSTLNCDTRC 8 S+ G +S G+ + FL++ K +TP L+ DTRC Sbjct: 2608 SSYGFQYSPGQR--VEFLVQAWKSKKTPMGLSYDTRC 2642 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 24,817,421 Number of Sequences: 219361 Number of extensions: 350424 Number of successful extensions: 791 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 787 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 791 length of database: 80,573,946 effective HSP length: 39 effective length of database: 72,018,867 effective search space used: 1728452808 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)