Clone Name | basd3i24 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | TSHR_HUMAN (P16473) Thyrotropin receptor precursor (TSH-R) (Thyr... | 29 | 9.7 |
---|
>TSHR_HUMAN (P16473) Thyrotropin receptor precursor (TSH-R)| (Thyroid-stimulating hormone receptor) Length = 764 Score = 29.3 bits (64), Expect = 9.7 Identities = 20/48 (41%), Positives = 27/48 (56%), Gaps = 7/48 (14%) Frame = -3 Query: 516 ELRAMLGNPPPCACHQE------YKGMRRKPSIIQNPAT-TLRRIEQH 394 +L M + PPC CHQE K ++R PS+ P+T TL+ IE H Sbjct: 18 DLGGMGCSSPPCECHQEEDFRVTCKDIQRIPSL--PPSTQTLKLIETH 63 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 67,792,158 Number of Sequences: 219361 Number of extensions: 1119675 Number of successful extensions: 2692 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 2650 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2691 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 5596027262 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)