| Clone Name | basd3h19 |
|---|---|
| Clone Library Name | barley_pub |
>COX2_APILI (P20375) Cytochrome c oxidase subunit 2 (EC 1.9.3.1) (Cytochrome c| oxidase polypeptide II) Length = 225 Score = 30.4 bits (67), Expect = 3.8 Identities = 12/29 (41%), Positives = 16/29 (55%) Frame = -2 Query: 414 PARVRRSNLLGRRPGRLFGSRHSGCRSNH 328 P R+ + NL+ +RPG FG C NH Sbjct: 174 PGRINQLNLISKRPGIFFGQCSEICGMNH 202
>COX2_APIKO (P50268) Cytochrome c oxidase subunit 2 (EC 1.9.3.1) (Cytochrome c| oxidase polypeptide II) Length = 225 Score = 30.4 bits (67), Expect = 3.8 Identities = 12/29 (41%), Positives = 16/29 (55%) Frame = -2 Query: 414 PARVRRSNLLGRRPGRLFGSRHSGCRSNH 328 P R+ + NL+ +RPG FG C NH Sbjct: 174 PGRINQLNLISKRPGIFFGQCSEICGMNH 202
>COX2_APIFL (P50267) Cytochrome c oxidase subunit 2 (EC 1.9.3.1) (Cytochrome c| oxidase polypeptide II) Length = 225 Score = 30.4 bits (67), Expect = 3.8 Identities = 12/29 (41%), Positives = 16/29 (55%) Frame = -2 Query: 414 PARVRRSNLLGRRPGRLFGSRHSGCRSNH 328 P R+ + NL+ +RPG FG C NH Sbjct: 174 PGRINQLNLISKRPGIFFGQCSEICGMNH 202
>RSP2_CAEEL (Q23120) Probable splicing factor, arginine/serine-rich 2| (RNA-binding protein srp-4) (CeSRp40) Length = 281 Score = 29.6 bits (65), Expect = 6.5 Identities = 12/27 (44%), Positives = 16/27 (59%) Frame = +2 Query: 455 PRRHRGGRSPVCRKAPPSRREGPPASR 535 PRR RSP ++PP+RR P + R Sbjct: 194 PRRRSRSRSPTRSRSPPARRRSPGSDR 220
>SGG_DROME (P18431) Protein kinase shaggy (EC 2.7.11.1) (Protein zeste-white 3)| Length = 1067 Score = 29.3 bits (64), Expect = 8.5 Identities = 13/46 (28%), Positives = 24/46 (52%) Frame = +1 Query: 442 KVVSASAAPRGKKPGLSQSASFPARGTTGIKKGGAMTSLAKQAKPE 579 K + ++ P G +P +AS A G+T + G+ S+ A+P+ Sbjct: 932 KHLQNASGPGGNRPSAGGAASIAASGSTSVSSTGSGASVEGSAQPQ 977
>COX2_RHIDA (Q37643) Cytochrome c oxidase subunit 2 (EC 1.9.3.1) (Cytochrome c| oxidase polypeptide II) Length = 227 Score = 29.3 bits (64), Expect = 8.5 Identities = 12/29 (41%), Positives = 16/29 (55%) Frame = -2 Query: 414 PARVRRSNLLGRRPGRLFGSRHSGCRSNH 328 P R+ ++ LL RPG +G C SNH Sbjct: 176 PGRLNQTTLLSNRPGLYYGQCSEICGSNH 204
>COX2_CTEFE (P29872) Cytochrome c oxidase subunit 2 (EC 1.9.3.1) (Cytochrome c| oxidase polypeptide II) Length = 227 Score = 29.3 bits (64), Expect = 8.5 Identities = 12/29 (41%), Positives = 16/29 (55%) Frame = -2 Query: 414 PARVRRSNLLGRRPGRLFGSRHSGCRSNH 328 P R+ +SN + RPG FG C +NH Sbjct: 176 PGRLNQSNFMMNRPGLYFGQCSEICGANH 204
>COX2_SIMVI (P98021) Cytochrome c oxidase subunit 2 (EC 1.9.3.1) (Cytochrome c| oxidase polypeptide II) Length = 229 Score = 29.3 bits (64), Expect = 8.5 Identities = 12/29 (41%), Positives = 16/29 (55%) Frame = -2 Query: 414 PARVRRSNLLGRRPGRLFGSRHSGCRSNH 328 P R+ ++N L RPG FG C +NH Sbjct: 176 PGRLNQTNFLMNRPGLFFGQCSEICGANH 204
>PHC1_HUMAN (P78364) Polyhomeotic-like protein 1 (hPH1) (Early development| regulatory protein 1) Length = 1004 Score = 29.3 bits (64), Expect = 8.5 Identities = 18/53 (33%), Positives = 24/53 (45%), Gaps = 9/53 (16%) Frame = +1 Query: 424 GNVLNGKVVSASAAPRGKKPGLSQSAS---------FPARGTTGIKKGGAMTS 555 G V +G+ AS+ P + PG Q P +GT + KGGA TS Sbjct: 560 GTVQSGQAHLASSPPSSQAPGALQECPPTLAPGMTLAPVQGTAHVVKGGATTS 612 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 63,354,647 Number of Sequences: 219361 Number of extensions: 1100904 Number of successful extensions: 4066 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 3866 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4060 length of database: 80,573,946 effective HSP length: 106 effective length of database: 57,321,680 effective search space used: 4929664480 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)