Clone Name | basd3f22 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
---|---|---|---|
1 | DMBT1_PIG (Q4A3R3) Deleted in malignant brain tumors 1 protein p... | 32 | 1.6 |
2 | CP74A_ARATH (Q96242) Cytochrome P450 74A, chloroplast precursor ... | 31 | 2.1 |
3 | SYP2L_HUMAN (Q9H987) Synaptopodin 2-like protein | 30 | 3.5 |
4 | ZN580_MOUSE (Q9DB38) Zinc finger protein 580 | 30 | 3.5 |
5 | ITA5_HUMAN (P08648) Integrin alpha-5 precursor (Fibronectin rece... | 30 | 4.6 |
>DMBT1_PIG (Q4A3R3) Deleted in malignant brain tumors 1 protein precursor| Length = 1204 Score = 31.6 bits (70), Expect = 1.6 Identities = 18/46 (39%), Positives = 21/46 (45%) Frame = +3 Query: 75 YILQRRSAWYEPRGEAIASPRGSYFSAAALGTRTSARGIFSTPSYP 212 Y W+ P ASP S+ G TSA G FS+PSYP Sbjct: 494 YTTTPSQTWWHPTTTTAASP-----SSPCGGFLTSASGTFSSPSYP 534
>CP74A_ARATH (Q96242) Cytochrome P450 74A, chloroplast precursor (EC 4.2.1.92)| (Allene oxide synthase) (Hydroperoxide dehydrase) Length = 518 Score = 31.2 bits (69), Expect = 2.1 Identities = 24/70 (34%), Positives = 35/70 (50%), Gaps = 2/70 (2%) Frame = +1 Query: 13 SGTGTLLLKVVRAFPGSMASVTYFSAVAPGMSLVEKQLL--VHGAHTSALQRLVLGPRLE 186 S GT + RAF G+ + T A APG L+ K +L +H + L R++ P + Sbjct: 212 SSDGTAFNFLARAFYGTNPADTKLKADAPG--LITKWVLFNLHPLLSIGLPRVIEEPLIH 269 Query: 187 AFSLPLLTLK 216 FSLP +K Sbjct: 270 TFSLPPALVK 279
>SYP2L_HUMAN (Q9H987) Synaptopodin 2-like protein| Length = 977 Score = 30.4 bits (67), Expect = 3.5 Identities = 22/67 (32%), Positives = 29/67 (43%) Frame = -3 Query: 205 EGVEKMPRAEVRVPSAAALKYEPRGLAIASPRGSYQALRR*SM*PMPYSQEKLERPSTKG 26 EG++ PRA+ P AA L P +ASPR + P P + RP T G Sbjct: 417 EGLQSPPRAQSAPPEAAVLPPSPLPAPVASPRPFQPGGGAPT--PAPSIFNRSARPFTPG 474 Query: 25 YLYPKPT 5 +PT Sbjct: 475 LQGQRPT 481
>ZN580_MOUSE (Q9DB38) Zinc finger protein 580| Length = 172 Score = 30.4 bits (67), Expect = 3.5 Identities = 12/23 (52%), Positives = 15/23 (65%) Frame = -2 Query: 419 IQCPENPRFPPQGSSTEGESGPK 351 +Q E PR PPQ +T GE GP+ Sbjct: 67 VQLEEEPRGPPQREATPGEPGPR 89
>ITA5_HUMAN (P08648) Integrin alpha-5 precursor (Fibronectin receptor alpha| subunit) (Integrin alpha-F) (VLA-5) (CD49e antigen) [Contains: Integrin alpha-5 heavy chain; Integrin alpha-5 light chain] Length = 1049 Score = 30.0 bits (66), Expect = 4.6 Identities = 19/58 (32%), Positives = 25/58 (43%) Frame = +3 Query: 42 RSSFSWEYGIGYILQRRSAWYEPRGEAIASPRGSYFSAAALGTRTSARGIFSTPSYPE 215 RS FSW G GY SA + G + GSYF + + T + + YPE Sbjct: 193 RSDFSWAAGQGYCQGGFSAEFTKTGRVVLGGPGSYFWQGQILSATQEQ--IAESYYPE 248 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 84,764,315 Number of Sequences: 219361 Number of extensions: 1869788 Number of successful extensions: 5014 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 4762 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5010 length of database: 80,573,946 effective HSP length: 106 effective length of database: 57,321,680 effective search space used: 4528412720 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)