Clone Name | basd2p24 |
---|---|
Clone Library Name | barley_pub |
>OMP19_RHILO (Q98EC1) Outer membrane lipoprotein omp19 homolog precursor| Length = 179 Score = 32.0 bits (71), Expect = 0.68 Identities = 18/53 (33%), Positives = 23/53 (43%) Frame = -3 Query: 166 PGAPSSRRPGLAPRPPSGTLVAVEEPAGCSCCSPSGYVRPLASGAWCAVVSGR 8 P +P S P P P+ T VA P G + S +G W A VSG+ Sbjct: 53 PASPGSTDPSKFPTAPANTQVASLPPDGQAPAGASDLSAAAVAGVWNASVSGQ 105
>IBP1_MOUSE (P47876) Insulin-like growth factor-binding protein 1 precursor| (IGFBP-1) (IBP-1) (IGF-binding protein 1) Length = 272 Score = 30.8 bits (68), Expect = 1.5 Identities = 19/55 (34%), Positives = 26/55 (47%) Frame = -3 Query: 172 CSPGAPSSRRPGLAPRPPSGTLVAVEEPAGCSCCSPSGYVRPLASGAWCAVVSGR 8 C+P ++ R GL P P+ + + PAGC CC L GA C V + R Sbjct: 32 CAPC--TAERLGLCPPVPA-SCPEISRPAGCGCCPTCA----LPMGAACGVATAR 79
>BRCA2_RAT (O35923) Breast cancer type 2 susceptibility protein homolog (Fanconi| anemia group D1 protein homolog) Length = 3343 Score = 30.4 bits (67), Expect = 2.0 Identities = 20/68 (29%), Positives = 25/68 (36%), Gaps = 14/68 (20%) Frame = -3 Query: 175 WCSPGAPSSRRP--------------GLAPRPPSGTLVAVEEPAGCSCCSPSGYVRPLAS 38 W +P +R P G PR + P SCC+P+G PLA Sbjct: 3118 WSTPNKDPTREPYPASTCSASDLASGGQLPRSSPTDQQSYRSPL--SCCTPTGKSTPLAH 3175 Query: 37 GAWCAVVS 14 AW A S Sbjct: 3176 SAWMAAKS 3183
>WNT9B_MOUSE (O35468) Protein Wnt-9b precursor (Wnt-15) (Wnt-14b)| Length = 359 Score = 30.0 bits (66), Expect = 2.6 Identities = 22/53 (41%), Positives = 27/53 (50%) Frame = -3 Query: 181 WIWCSPGAPSSRRPGLAPRPPSGTLVAVEEPAGCSCCSPSGYVRPLASGAWCA 23 W PG P+ GLAPRP G LV +E+ S C PS Y P +G C+ Sbjct: 264 WAPAKPGGPAK---GLAPRP--GDLVYMEDSP--SFCRPSKY-SPGTAGRVCS 308
>XKR4_PANTR (Q49LS4) XK-related protein 4| Length = 650 Score = 29.3 bits (64), Expect = 4.4 Identities = 14/27 (51%), Positives = 15/27 (55%) Frame = -3 Query: 139 GLAPRPPSGTLVAVEEPAGCSCCSPSG 59 GLAP PSG+ EE AG CC G Sbjct: 33 GLAPGLPSGSGAEDEEAAGGGCCPDGG 59
>XKR4_HUMAN (Q5GH76) XK-related protein 4| Length = 650 Score = 29.3 bits (64), Expect = 4.4 Identities = 14/27 (51%), Positives = 15/27 (55%) Frame = -3 Query: 139 GLAPRPPSGTLVAVEEPAGCSCCSPSG 59 GLAP PSG+ EE AG CC G Sbjct: 33 GLAPGLPSGSGAEDEEAAGGGCCPDGG 59
>VGLL2_MOUSE (Q8BGW8) Transcription cofactor vestigial-like protein 2 (Vgl-2)| (VITO1 protein) Length = 322 Score = 29.3 bits (64), Expect = 4.4 Identities = 22/59 (37%), Positives = 28/59 (47%), Gaps = 6/59 (10%) Frame = -3 Query: 163 GAPSSRRPGLAPRP--PSGTLVAVEEPAGCSCCSPSG-YVRP---LASGAWCAVVSGRR 5 G P P AP P P L A EPAG + +P G +V P +A +V SG+R Sbjct: 246 GRPGRLAPASAPAPGSPPCELAAKGEPAGSAWAAPGGPFVSPTGDVAQSLGLSVDSGKR 304
>PDLI7_CHICK (Q679P3) PDZ and LIM domain protein 7 (LIM mineralization protein)| Length = 416 Score = 28.9 bits (63), Expect = 5.8 Identities = 12/20 (60%), Positives = 13/20 (65%) Frame = -3 Query: 169 SPGAPSSRRPGLAPRPPSGT 110 SPGA PGLAPR P+ T Sbjct: 159 SPGAAMKTEPGLAPRTPAAT 178
>YAP1_CHICK (P46936) 65 kDa Yes-associated protein (YAP65)| Length = 448 Score = 28.5 bits (62), Expect = 7.6 Identities = 14/44 (31%), Positives = 22/44 (50%) Frame = -3 Query: 166 PGAPSSRRPGLAPRPPSGTLVAVEEPAGCSCCSPSGYVRPLASG 35 PG P ++P A +PP+ A +P G +P G +P +G Sbjct: 3 PGQPQPQQPPQAAQPPA-PQQAAPQPPGAGSGAPGGAAQPPGAG 45
>ROBO3_MOUSE (Q9Z2I4) Roundabout homolog 3 precursor (Retinoblastoma-inhibiting| gene 1) (Rig-1) Length = 1366 Score = 28.5 bits (62), Expect = 7.6 Identities = 12/28 (42%), Positives = 15/28 (53%) Frame = -3 Query: 121 PSGTLVAVEEPAGCSCCSPSGYVRPLAS 38 P +VAV EPA C P G+ PL + Sbjct: 172 PGNVVVAVGEPAVMECVPPKGHPEPLVT 199
>EPHB1_HUMAN (P54762) Ephrin type-B receptor 1 precursor (EC 2.7.10.1)| (Tyrosine-protein kinase receptor EPH-2) (NET) (HEK6) (ELK) Length = 984 Score = 28.5 bits (62), Expect = 7.6 Identities = 19/62 (30%), Positives = 25/62 (40%), Gaps = 7/62 (11%) Frame = -3 Query: 175 WCSPGAPSSRRPGLAPRP-------PSGTLVAVEEPAGCSCCSPSGYVRPLASGAWCAVV 17 W P + +PG P P+GT A +E GCS C PS P + C Sbjct: 246 WMVPIGRCTCKPGYEPENSVACKACPAGTFKASQEAEGCSHC-PSNSRSPAEASPICTCR 304 Query: 16 SG 11 +G Sbjct: 305 TG 306
>YL253_YEAST (Q06567) ABC1 family protein YLR253W| Length = 569 Score = 28.1 bits (61), Expect = 9.9 Identities = 11/20 (55%), Positives = 15/20 (75%) Frame = -2 Query: 212 RHPSMKPFSPLDLVLARRPF 153 +HPS+K F PLD++L R F Sbjct: 212 QHPSLKEFIPLDVMLTRTVF 231
>ACVL1_RAT (P80203) Serine/threonine-protein kinase receptor R3 precursor (EC| 2.7.11.30) (SKR3) (TGF-B superfamily receptor type I) (TSR-I) Length = 504 Score = 28.1 bits (61), Expect = 9.9 Identities = 15/37 (40%), Positives = 19/37 (51%) Frame = -3 Query: 127 RPPSGTLVAVEEPAGCSCCSPSGYVRPLASGAWCAVV 17 +P G LV C+C +P RP+ GAWC VV Sbjct: 26 KPSRGQLV------NCTCENPH-CKRPICQGAWCTVV 55 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 54,216,372 Number of Sequences: 219361 Number of extensions: 916089 Number of successful extensions: 3178 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 3037 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3175 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2570413340 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)