| Clone Name | basd3d23 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | MATK_STYHA (Q9TK08) Maturase K (Intron maturase) | 29 | 6.2 | 2 | VIE1_MCMVS (P11210) Immediate-early protein 1 (IE1) (Immediate-e... | 29 | 6.2 |
|---|
>MATK_STYHA (Q9TK08) Maturase K (Intron maturase)| Length = 509 Score = 28.9 bits (63), Expect = 6.2 Identities = 12/19 (63%), Positives = 14/19 (73%) Frame = -2 Query: 441 LLFLFYISNPRAFLILYNF 385 ++F F SNPR FL LYNF Sbjct: 198 IIFTFSKSNPRFFLFLYNF 216
>VIE1_MCMVS (P11210) Immediate-early protein 1 (IE1) (Immediate-early| phosphoprotein PP89) Length = 595 Score = 28.9 bits (63), Expect = 6.2 Identities = 12/42 (28%), Positives = 21/42 (50%) Frame = +3 Query: 258 PFYFRPLFPISXXXXIWMSM*PIESCSYNTYIIVCITIRKRK 383 P Y +P +W M IES S +T+++V ++ R+ Sbjct: 237 PCYTKPFLDAKSQLAVWQQMKAIESESVSTHVVVVEALKLRE 278 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 61,073,482 Number of Sequences: 219361 Number of extensions: 1164611 Number of successful extensions: 2245 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2197 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2244 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2735358828 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)