| Clone Name | basd2o18 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | SRG8_CAEEL (P46565) Serpentine receptor class gamma-8 (Protein s... | 28 | 8.5 | 2 | SIN3B_HUMAN (O75182) Paired amphipathic helix protein Sin3b (Tra... | 28 | 8.5 |
|---|
>SRG8_CAEEL (P46565) Serpentine receptor class gamma-8 (Protein srg-8)| Length = 316 Score = 27.7 bits (60), Expect = 8.5 Identities = 14/26 (53%), Positives = 17/26 (65%), Gaps = 3/26 (11%) Frame = -2 Query: 209 LWGV*HGSFF---FSRYIILNLFSPF 141 LW V H F+ FSR +ILNL +PF Sbjct: 134 LWPVDHEKFWKINFSRILILNLIAPF 159
>SIN3B_HUMAN (O75182) Paired amphipathic helix protein Sin3b (Transcriptional| corepressor Sin3b) (Histone deacetylase complex subunit Sin3b) Length = 1162 Score = 27.7 bits (60), Expect = 8.5 Identities = 11/31 (35%), Positives = 20/31 (64%) Frame = +1 Query: 109 TTYPYR*XQC*KGENRFKIMYLEKKKEPCQT 201 T+Y ++ +C EN FK+M+L++K + T Sbjct: 937 TSYQWKAERCMADENCFKVMFLQRKGQVIMT 967 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 26,366,915 Number of Sequences: 219361 Number of extensions: 347912 Number of successful extensions: 582 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 564 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 582 length of database: 80,573,946 effective HSP length: 45 effective length of database: 70,702,701 effective search space used: 1696864824 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)