| Clone Name | basd3b13 |
|---|---|
| Clone Library Name | barley_pub |
>NFE2_HUMAN (Q16621) Transcription factor NF-E2 45 kDa subunit (Nuclear factor,| erythroid-derived 2 45 kDa subunit) (p45 NF-E2) (Leucine zipper protein NF-E2) Length = 373 Score = 31.6 bits (70), Expect = 1.9 Identities = 21/72 (29%), Positives = 30/72 (41%), Gaps = 4/72 (5%) Frame = -2 Query: 485 PCPHFPQPPYHRQLVHSLWHYCPVTCSPTG----VQPPTSLPSSAPTGSHPPLALGHLQL 318 P P+ PP YCP + P PP LP+S PP + G++ + Sbjct: 53 PAPYLGPPPPTT--------YCPCSIHPDSGFPLPPPPYELPASTSHVPDPPYSYGNMAI 104 Query: 317 SVSWNLPAAGVL 282 VS L +G+L Sbjct: 105 PVSKPLSLSGLL 116
>CSF1_ASHGO (Q74ZX0) Protein CSF1| Length = 2887 Score = 31.2 bits (69), Expect = 2.5 Identities = 16/33 (48%), Positives = 20/33 (60%), Gaps = 1/33 (3%) Frame = +1 Query: 178 GTLVWQYWLSGRY-AS*SIEKARSCC*AGKSNG 273 GT+ W+YWL GRY S + + AR C A K G Sbjct: 66 GTITWRYWLIGRYRRSGTADGARRCRFALKFEG 98
>SNRPA_MOUSE (Q62189) U1 small nuclear ribonucleoprotein A (U1 snRNP protein A)| (U1A protein) (U1-A) Length = 286 Score = 30.8 bits (68), Expect = 3.3 Identities = 15/57 (26%), Positives = 24/57 (42%) Frame = -2 Query: 503 LLDCLHPCPHFPQPPYHRQLVHSLWHYCPVTCSPTGVQPPTSLPSSAPTGSHPPLAL 333 ++ + P P P P +++H + P P + PP P P G+ PP L Sbjct: 138 VVGAVQPVPGMPPMPQAPRIMHHMPGQPPYMPPPGMIPPPGLAPGQIPPGAMPPQQL 194
>APA_MYCAV (Q48919) Alanine and proline-rich secreted protein apa precursor| (45/47 kDa antigen) (Fibronectin attachment protein) (FAP-A) Length = 381 Score = 30.0 bits (66), Expect = 5.6 Identities = 16/49 (32%), Positives = 22/49 (44%), Gaps = 1/49 (2%) Frame = -2 Query: 485 PCPHFPQ-PPYHRQLVHSLWHYCPVTCSPTGVQPPTSLPSSAPTGSHPP 342 P P+ Q PP R+++ P P PP P +AP G+ PP Sbjct: 77 PAPNGQQRPPRRRRMI-------PTRAPPPAGAPPNGAPPAAPNGAPPP 118
>RAPH1_HUMAN (Q70E73) Ras-associated and pleckstrin homology domains-containing| protein 1 (RAPH1) (Lamellipodin) (Proline-rich EVH1 ligand 2) (PREL-2) (Protein RMO1) (Amyotrophic lateral sclerosis 2 chromosomal region candidate 9 gene protein) Length = 1302 Score = 30.0 bits (66), Expect = 5.6 Identities = 16/43 (37%), Positives = 20/43 (46%) Frame = -2 Query: 485 PCPHFPQPPYHRQLVHSLWHYCPVTCSPTGVQPPTSLPSSAPT 357 P P FP PP LV + P SP PP P+++PT Sbjct: 964 PSPDFPPPPPESSLV-----FPPPPPSPVPAPPPPPPPTASPT 1001
>RSE1_CANAL (Q5A7S5) Pre-mRNA-splicing factor RSE1| Length = 1219 Score = 30.0 bits (66), Expect = 5.6 Identities = 16/50 (32%), Positives = 29/50 (58%) Frame = +2 Query: 350 ENQWGRNWVERWVAVRPWENRLLDSNAKESVPIGDDKEAEENGDRDVNNP 499 +N WGRN+V +A+ P ENR + A E + E+ +G +++++P Sbjct: 151 KNGWGRNYVGENLAIDP-ENRCILVAAMEKNKLFYKIESNSSGSKELSSP 199
>ACRO_RAT (P29293) Acrosin precursor (EC 3.4.21.10) [Contains: Acrosin light| chain; Acrosin heavy chain] Length = 437 Score = 30.0 bits (66), Expect = 5.6 Identities = 20/65 (30%), Positives = 30/65 (46%), Gaps = 6/65 (9%) Frame = -2 Query: 509 LFLLDCLHPCPHFPQPP---YHRQLVHSLWHYCPVTCSPTGVQPPTSL---PSSAPTGSH 348 L L+ P P Q P +H +H W++ ++ P ++PP L PSS T S Sbjct: 295 LHLIQPATPHPPTTQQPVISFHPPSIHPPWYFQHLSPRPPHLRPPRPLLHQPSSVHTSSA 354 Query: 347 PPLAL 333 P + L Sbjct: 355 PVIPL 359
>E75BC_DROME (P17671) Ecdysone-induced protein 75B isoforms C/D (E75-A)| Length = 1199 Score = 29.6 bits (65), Expect = 7.3 Identities = 28/99 (28%), Positives = 42/99 (42%), Gaps = 12/99 (12%) Frame = -2 Query: 590 HLHQNVTSCVLHLSSGLNHLTECPKLQLFLLDCLHPC---PHFPQPPYHR-----QLVHS 435 H N TS SSG N T +LQ+ + D P P PP + ++ Sbjct: 1085 HSTSNGTSAPASSSSGSNSATPLLELQVDIADSAQPLNLSKKSPTPPPSKLHALVAAANA 1144 Query: 434 LWHY----CPVTCSPTGVQPPTSLPSSAPTGSHPPLALG 330 + Y VT + + PP++ S AP+ S PP ++G Sbjct: 1145 VQRYPTLSADVTVTASNGGPPSAAASPAPSSS-PPASVG 1182
>E75BA_DROME (P17672) Ecdysone-induced protein 75B isoform A (E75-B)| Length = 1355 Score = 29.6 bits (65), Expect = 7.3 Identities = 28/99 (28%), Positives = 42/99 (42%), Gaps = 12/99 (12%) Frame = -2 Query: 590 HLHQNVTSCVLHLSSGLNHLTECPKLQLFLLDCLHPC---PHFPQPPYHR-----QLVHS 435 H N TS SSG N T +LQ+ + D P P PP + ++ Sbjct: 1241 HSTSNGTSAPASSSSGSNSATPLLELQVDIADSAQPLNLSKKSPTPPPSKLHALVAAANA 1300 Query: 434 LWHY----CPVTCSPTGVQPPTSLPSSAPTGSHPPLALG 330 + Y VT + + PP++ S AP+ S PP ++G Sbjct: 1301 VQRYPTLSADVTVTASNGGPPSAAASPAPSSS-PPASVG 1338
>SRBS1_HUMAN (Q9BX66) Sorbin and SH3 domain-containing protein 1 (Ponsin)| (c-Cbl-associated protein) (CAP) (SH3 domain protein 5) (SH3P12) Length = 1292 Score = 29.6 bits (65), Expect = 7.3 Identities = 12/40 (30%), Positives = 19/40 (47%) Frame = -2 Query: 479 PHFPQPPYHRQLVHSLWHYCPVTCSPTGVQPPTSLPSSAP 360 PH + P+H Q + + P++ +P PP L AP Sbjct: 213 PHLQRWPHHSQPARASGSFAPISQTPPSFSPPPPLVPPAP 252
>TRME_CHLMU (Q9PLM9) Probable tRNA modification GTPase trmE| Length = 444 Score = 29.6 bits (65), Expect = 7.3 Identities = 17/52 (32%), Positives = 24/52 (46%) Frame = -2 Query: 509 LFLLDCLHPCPHFPQPPYHRQLVHSLWHYCPVTCSPTGVQPPTSLPSSAPTG 354 L+++D P P FP Y + + LW+ C V P P + SA TG Sbjct: 300 LWVMDASQPVPEFPAILYQKPTI-LLWNKCDVASPPQLEVPFQQIFVSAKTG 350
>ATN1_PANTR (Q5IS70) Atrophin-1 (Dentatorubral-pallidoluysian atrophy protein)| Length = 1186 Score = 29.6 bits (65), Expect = 7.3 Identities = 25/58 (43%), Positives = 29/58 (50%), Gaps = 9/58 (15%) Frame = -2 Query: 488 HPCPHFP---QPPYH--RQLVHSLWHYCPVTCSPTG----VQPPTSLPSSAPTGSHPP 342 HP P FP QPP RQ S + VT PTG ++PPTS AP G+ PP Sbjct: 159 HPPPLFPPSPQPPDSTPRQPEASFEPHPSVT--PTGYHAPMEPPTSRMFQAPPGAPPP 214
>ENAH_HUMAN (Q8N8S7) Protein enabled homolog| Length = 591 Score = 29.6 bits (65), Expect = 7.3 Identities = 22/62 (35%), Positives = 25/62 (40%) Frame = -2 Query: 527 ECPKLQLFLLDCLHPCPHFPQPPYHRQLVHSLWHYCPVTCSPTGVQPPTSLPSSAPTGSH 348 E P Q +L L P P P PP Q +L P G PP LPS+ P Sbjct: 299 ETPSQQGIVLGPLAPPPPPPLPPGPAQASVAL-------PPPPGPPPPPPLPSTGPPPPP 351 Query: 347 PP 342 PP Sbjct: 352 PP 353
>E75BB_DROME (P13055) Ecdysone-induced protein 75B isoform B (E75-C)| Length = 1412 Score = 29.6 bits (65), Expect = 7.3 Identities = 28/99 (28%), Positives = 42/99 (42%), Gaps = 12/99 (12%) Frame = -2 Query: 590 HLHQNVTSCVLHLSSGLNHLTECPKLQLFLLDCLHPC---PHFPQPPYHR-----QLVHS 435 H N TS SSG N T +LQ+ + D P P PP + ++ Sbjct: 1298 HSTSNGTSAPASSSSGSNSATPLLELQVDIADSAQPLNLSKKSPTPPPSKLHALVAAANA 1357 Query: 434 LWHY----CPVTCSPTGVQPPTSLPSSAPTGSHPPLALG 330 + Y VT + + PP++ S AP+ S PP ++G Sbjct: 1358 VQRYPTLSADVTVTASNGGPPSAAASPAPSSS-PPASVG 1395
>ATN1_HUMAN (P54259) Atrophin-1 (Dentatorubral-pallidoluysian atrophy protein)| Length = 1185 Score = 29.6 bits (65), Expect = 7.3 Identities = 25/58 (43%), Positives = 29/58 (50%), Gaps = 9/58 (15%) Frame = -2 Query: 488 HPCPHFP---QPPYH--RQLVHSLWHYCPVTCSPTG----VQPPTSLPSSAPTGSHPP 342 HP P FP QPP RQ S + VT PTG ++PPTS AP G+ PP Sbjct: 160 HPPPLFPPSPQPPDSTPRQPEASFEPHPSVT--PTGYHAPMEPPTSRMFQAPPGAPPP 215
>SFSA_PSEPK (Q88DX7) Sugar fermentation stimulation protein homolog| Length = 237 Score = 29.6 bits (65), Expect = 7.3 Identities = 11/35 (31%), Positives = 17/35 (48%) Frame = +1 Query: 25 ASSRNTSVHAITSKGSSSCQSKTGSYWFGRSGDPE 129 AS ++H + +C + G WF RS DP+ Sbjct: 26 ASGEQMTIHCPNTGSMLNCMREGGQVWFSRSNDPK 60
>STP2_RAT (P11101) Nuclear transition protein 2 (TP-2) (TP2)| Length = 114 Score = 29.3 bits (64), Expect = 9.6 Identities = 18/53 (33%), Positives = 23/53 (43%), Gaps = 1/53 (1%) Frame = -2 Query: 500 LDCLHPCPHFP-QPPYHRQLVHSLWHYCPVTCSPTGVQPPTSLPSSAPTGSHP 345 L HP PH +P H + H+C +CS G +S PS P HP Sbjct: 8 LPTTHPHPHSSSRPQSHTNNQCACSHHCR-SCSQAGHPSSSSSPSPGPPTKHP 59
>EMS_DROME (P18488) Homeotic protein empty spiracles| Length = 497 Score = 29.3 bits (64), Expect = 9.6 Identities = 25/86 (29%), Positives = 36/86 (41%), Gaps = 2/86 (2%) Frame = -2 Query: 608 IAPMKNHLHQN--VTSCVLHLSSGLNHLTECPKLQLFLLDCLHPCPHFPQPPYHRQLVHS 435 I + LH N + S + L + L+ TE P++ + L P PP Q + Sbjct: 143 IQELLQRLHHNAAMASGLSPLQTRLSPETEQPQMAVSLKR-----ERSPAPPAMEQAENP 197 Query: 434 LWHYCPVTCSPTGVQPPTSLPSSAPT 357 P P V P +S PSS+PT Sbjct: 198 AQRIQPPHTPPKSVSPQSSQPSSSPT 223
>VGLB_EHV1V (Q6S6T9) Glycoprotein B precursor (Glycoprotein 14)| Length = 980 Score = 29.3 bits (64), Expect = 9.6 Identities = 14/29 (48%), Positives = 16/29 (55%) Frame = -2 Query: 434 LWHYCPVTCSPTGVQPPTSLPSSAPTGSH 348 L+ C V PT PPTS P+S T SH Sbjct: 77 LFGSCVVRAVPTTPSPPTSTPTSMSTHSH 105
>VGLB_EHV1D (P25218) Glycoprotein B precursor (Glycoprotein 14)| Length = 980 Score = 29.3 bits (64), Expect = 9.6 Identities = 14/29 (48%), Positives = 16/29 (55%) Frame = -2 Query: 434 LWHYCPVTCSPTGVQPPTSLPSSAPTGSH 348 L+ C V PT PPTS P+S T SH Sbjct: 77 LFGSCVVRAVPTTPSPPTSTPTSMSTHSH 105
>VGLB_EHV1B (Q6DLH8) Glycoprotein B precursor (Glycoprotein 14)| Length = 980 Score = 29.3 bits (64), Expect = 9.6 Identities = 14/29 (48%), Positives = 16/29 (55%) Frame = -2 Query: 434 LWHYCPVTCSPTGVQPPTSLPSSAPTGSH 348 L+ C V PT PPTS P+S T SH Sbjct: 77 LFGSCVVRAVPTTPSPPTSTPTSMSTHSH 105
>VGLB_EHV1A (P18551) Glycoprotein B precursor (Glycoprotein 14)| Length = 980 Score = 29.3 bits (64), Expect = 9.6 Identities = 14/29 (48%), Positives = 16/29 (55%) Frame = -2 Query: 434 LWHYCPVTCSPTGVQPPTSLPSSAPTGSH 348 L+ C V PT PPTS P+S T SH Sbjct: 77 LFGSCVVRAVPTTPSPPTSTPTSMSTHSH 105
>VGLB_EHV1 (P18050) Glycoprotein B precursor (Glycoprotein 14)| Length = 980 Score = 29.3 bits (64), Expect = 9.6 Identities = 14/29 (48%), Positives = 16/29 (55%) Frame = -2 Query: 434 LWHYCPVTCSPTGVQPPTSLPSSAPTGSH 348 L+ C V PT PPTS P+S T SH Sbjct: 77 LFGSCVVRAVPTTPSPPTSTPTSMSTHSH 105 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 84,881,142 Number of Sequences: 219361 Number of extensions: 1693636 Number of successful extensions: 6310 Number of sequences better than 10.0: 23 Number of HSP's better than 10.0 without gapping: 5589 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6266 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 5538924943 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)