Clone Name | basd3b10 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | T3RE_SALTY (P40815) Type III restriction-modification system Sty... | 32 | 0.83 | 2 | T3RE_BACC1 (P25241) Type III restriction-modification system Bce... | 28 | 7.1 | 3 | GID_LACLA (Q9CG79) tRNA uridine 5-carboxymethylaminomethyl modif... | 28 | 7.1 |
---|
>T3RE_SALTY (P40815) Type III restriction-modification system StyLTI enzyme res| (EC 3.1.21.5) Length = 990 Score = 31.6 bits (70), Expect = 0.83 Identities = 15/32 (46%), Positives = 19/32 (59%), Gaps = 1/32 (3%) Frame = +2 Query: 164 GSGLRLGLDENPDAIISGEWPENFS-LLSYDD 256 G GLRL +DEN + EWP S L+ YD+ Sbjct: 534 GRGLRLPVDENGHRVHQEEWPSRLSFLIGYDE 565
>T3RE_BACC1 (P25241) Type III restriction-modification system Bce10987IP enzyme| res (EC 3.1.21.5) Length = 987 Score = 28.5 bits (62), Expect = 7.1 Identities = 14/32 (43%), Positives = 18/32 (56%), Gaps = 1/32 (3%) Frame = +2 Query: 164 GSGLRLGLDENPDAIISGEWPENFS-LLSYDD 256 G GLRL +DE I EWP + L+ YD+ Sbjct: 536 GRGLRLPVDETGHRIQQDEWPTRLAFLIGYDE 567
>GID_LACLA (Q9CG79) tRNA uridine 5-carboxymethylaminomethyl modification| enzyme gid Length = 447 Score = 28.5 bits (62), Expect = 7.1 Identities = 10/25 (40%), Positives = 17/25 (68%) Frame = +2 Query: 2 RQHPQHKTRRIASMACINTLQSCSM 76 +Q PQHKT + A + C N+L+ ++ Sbjct: 38 KQTPQHKTDKFAELVCSNSLRGAAI 62 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 35,072,853 Number of Sequences: 219361 Number of extensions: 382527 Number of successful extensions: 1044 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1028 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1043 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2395157885 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)