| Clone Name | basd3b04 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | MT21_ORYSA (P94029) Metallothionein-like protein type 2 | 36 | 0.041 | 2 | SOX14_DROME (P40656) Putative transcription factor SOX-14 | 30 | 3.8 | 3 | FOXL2_HUMAN (P58012) Forkhead box protein L2 | 28 | 8.6 | 4 | SMG7_MOUSE (Q5RJH6) Protein SMG7 (SMG-7 homolog) (EST1-like prot... | 28 | 8.6 | 5 | MT1_MAIZE (P30571) Metallothionein-like protein 1 (MT-1) | 28 | 8.6 |
|---|
>MT21_ORYSA (P94029) Metallothionein-like protein type 2| Length = 82 Score = 36.2 bits (82), Expect = 0.041 Identities = 20/38 (52%), Positives = 24/38 (63%) Frame = +3 Query: 78 MYPGMDEGVSTTATSSQALVMGVASSKGNGPSFEAAAA 191 MYP M E V+TT Q ++MGVA SKG+ EA AA Sbjct: 25 MYPEMAEEVTTT----QTVIMGVAPSKGHAEGLEAGAA 58
>SOX14_DROME (P40656) Putative transcription factor SOX-14| Length = 472 Score = 29.6 bits (65), Expect = 3.8 Identities = 17/63 (26%), Positives = 26/63 (41%) Frame = -1 Query: 277 PSPCVDSTDHLQVHGLQVQLGPHLHPPFSAAAASNEGPLPLEDATPMTRAWEEVAVVLTP 98 P+P DST PH PPFS + + P P TP + + A + P Sbjct: 42 PAPKADST-------------PHTLPPFSPSPSPASSPSPAPAQTPGAQKTQSQAAITHP 88 Query: 97 SSI 89 +++ Sbjct: 89 AAV 91
>FOXL2_HUMAN (P58012) Forkhead box protein L2| Length = 376 Score = 28.5 bits (62), Expect = 8.6 Identities = 23/68 (33%), Positives = 26/68 (38%) Frame = -1 Query: 286 PSMPSPCVDSTDHLQVHGLQVQLGPHLHPPFSAAAASNEGPLPLEDATPMTRAWEEVAVV 107 P+ P P H H L P PP AAA G L A+P T A A Sbjct: 281 PAAPPPPPHPHPHPHAHHLHAAAAPPPAPPHHGAAAPPPG--QLSPASPATAAPPAPA-- 336 Query: 106 LTPSSIPG 83 P+S PG Sbjct: 337 --PTSAPG 342
>SMG7_MOUSE (Q5RJH6) Protein SMG7 (SMG-7 homolog) (EST1-like protein C)| Length = 1138 Score = 28.5 bits (62), Expect = 8.6 Identities = 16/41 (39%), Positives = 20/41 (48%) Frame = -1 Query: 283 SMPSPCVDSTDHLQVHGLQVQLGPHLHPPFSAAAASNEGPL 161 S+P + ST H G QVQ G H P+S S GP+ Sbjct: 641 SVPGTFLQSTAHSPA-GNQVQAGKQSHIPYSQQRPSGPGPM 680
>MT1_MAIZE (P30571) Metallothionein-like protein 1 (MT-1)| Length = 76 Score = 28.5 bits (62), Expect = 8.6 Identities = 15/38 (39%), Positives = 21/38 (55%) Frame = +3 Query: 81 YPGMDEGVSTTATSSQALVMGVASSKGNGPSFEAAAAE 194 YP ++E T+ + +V+GVA K P F AAAE Sbjct: 21 YPDLEE---TSTAAQPTVVLGVAPEKKAAPEFVEAAAE 55 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 47,595,753 Number of Sequences: 219361 Number of extensions: 811904 Number of successful extensions: 2336 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 2282 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2335 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2909956200 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)