Clone Name | basd2l22 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | YO125_YEAST (Q12383) Uncharacterized protein YOL125W | 42 | 9e-04 | 2 | SYH_UREPA (Q9PQK6) Histidyl-tRNA synthetase (EC 6.1.1.21) (Histi... | 29 | 7.9 | 3 | BIOD_SYNY3 (Q55849) Dethiobiotin synthetase (EC 6.3.3.3) (Dethio... | 29 | 7.9 |
---|
>YO125_YEAST (Q12383) Uncharacterized protein YOL125W| Length = 476 Score = 42.4 bits (98), Expect = 9e-04 Identities = 22/51 (43%), Positives = 34/51 (66%), Gaps = 2/51 (3%) Frame = -3 Query: 244 LTVKERENLGRLCKLLIDYGRVDYLQR--MGYIAALQYYTEPEVSLENVLL 98 +T+KEREN+G + + +ID GR+ Y++ + A L Y E +VSLENV + Sbjct: 421 ITIKERENIGLMARRVIDEGRLVYVKEKFTEFNAELIRYVESDVSLENVAM 471
>SYH_UREPA (Q9PQK6) Histidyl-tRNA synthetase (EC 6.1.1.21) (Histidine--tRNA| ligase) (HisRS) Length = 420 Score = 29.3 bits (64), Expect = 7.9 Identities = 15/44 (34%), Positives = 23/44 (52%) Frame = -3 Query: 262 PLIFRFLTVKERENLGRLCKLLIDYGRVDYLQRMGYIAALQYYT 131 P I FL+ +E+E + K+L DY + Y G + L YY+ Sbjct: 223 PKISHFLSNEEKEEFNLIKKMLDDY-NIKYYVNEGLVRGLDYYS 265
>BIOD_SYNY3 (Q55849) Dethiobiotin synthetase (EC 6.3.3.3) (Dethiobiotin| synthase) (DTB synthetase) (DTBS) Length = 237 Score = 29.3 bits (64), Expect = 7.9 Identities = 16/42 (38%), Positives = 26/42 (61%), Gaps = 2/42 (4%) Frame = -3 Query: 274 FTYVPL--IFRFLTVKERENLGRLCKLLIDYGRVDYLQRMGY 155 FT++P+ I +LT ERENL RL ++ +G L+++ Y Sbjct: 199 FTHLPVLGIVPYLTESERENLSRLAEITARFG----LEKLAY 236 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 72,941,098 Number of Sequences: 219361 Number of extensions: 1438348 Number of successful extensions: 2451 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2400 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2450 length of database: 80,573,946 effective HSP length: 105 effective length of database: 57,541,041 effective search space used: 4545742239 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)