| Clone Name | basd2l07 |
|---|---|
| Clone Library Name | barley_pub |
>PI5K1_ORYSA (Q6EX42) Phosphatidylinositol-4-phosphate 5-kinase 1 precursor (EC| 2.7.1.68) (1-phosphatidylinositol-4-phosphate kinase) (PIP5K) (PtdIns(4)P-5-kinase) (Diphosphoinositide kinase) Length = 801 Score = 46.6 bits (109), Expect = 2e-05 Identities = 19/23 (82%), Positives = 23/23 (100%) Frame = +3 Query: 30 SVDPNLYSKRFVSFLERVFPEQD 98 +VDPNLYS+RF+SFLE+VFPEQD Sbjct: 779 AVDPNLYSRRFISFLEKVFPEQD 801
>PI5K8_ARATH (Q8RY89) Phosphatidylinositol-4-phosphate 5-kinase 8 (EC 2.7.1.68)| (AtPIP5K8) (1-phosphatidylinositol-4-phosphate kinase 8) (PtdIns(4)P-5-kinase 8) (Diphosphoinositide kinase 8) Length = 769 Score = 35.0 bits (79), Expect = 0.048 Identities = 13/22 (59%), Positives = 19/22 (86%) Frame = +3 Query: 30 SVDPNLYSKRFVSFLERVFPEQ 95 +++P LYSKRF+ FL +VFPE+ Sbjct: 747 AIEPTLYSKRFIDFLLKVFPEK 768
>PI5K7_ARATH (Q9SUI2) Phosphatidylinositol-4-phosphate 5-kinase 7 (EC 2.7.1.68)| (AtPIP5K7) (1-phosphatidylinositol-4-phosphate kinase 7) (PtdIns(4)P-5-kinase 7) (Diphosphoinositide kinase 7) (AtP5K2) Length = 754 Score = 34.7 bits (78), Expect = 0.063 Identities = 16/26 (61%), Positives = 22/26 (84%), Gaps = 1/26 (3%) Frame = +3 Query: 21 LDISV-DPNLYSKRFVSFLERVFPEQ 95 + ISV +P+ YSKRFV+FL +VFPE+ Sbjct: 728 MTISVTEPSTYSKRFVNFLHKVFPEE 753
>PI5K1_ARATH (Q56YP2) Phosphatidylinositol-4-phosphate 5-kinase 1 (EC 2.7.1.68)| (AtPIP5K1) (1-phosphatidylinositol-4-phosphate kinase 1) (PtdIns(4)P-5-kinase 1) (Diphosphoinositide kinase 1) Length = 752 Score = 33.9 bits (76), Expect = 0.11 Identities = 15/30 (50%), Positives = 20/30 (66%) Frame = +3 Query: 6 QVRPSLDISVDPNLYSKRFVSFLERVFPEQ 95 Q P+ +VDP LYSKRF F+ R+F E+ Sbjct: 722 QADPASISAVDPKLYSKRFRDFISRIFIEE 751
>PI5K9_ARATH (Q8L850) Phosphatidylinositol-4-phosphate 5-kinase 9 (EC 2.7.1.68)| (AtPIP5K9) (1-phosphatidylinositol-4-phosphate kinase 9) (PtdIns(4)P-5-kinase 9) (Diphosphoinositide kinase 9) Length = 815 Score = 33.9 bits (76), Expect = 0.11 Identities = 15/28 (53%), Positives = 22/28 (78%), Gaps = 1/28 (3%) Frame = +3 Query: 18 SLDIS-VDPNLYSKRFVSFLERVFPEQD 98 SL IS VDP YS+RF+ F+++VFP+ + Sbjct: 786 SLSISAVDPTFYSQRFLEFIKKVFPQNN 813
>PI5K2_ARATH (Q8L796) Phosphatidylinositol-4-phosphate 5-kinase 2 (EC 2.7.1.68)| (AtPIP5K2) (1-phosphatidylinositol-4-phosphate kinase 2) (PtdIns(4)P-5-kinase 2) (Diphosphoinositide kinase 2) Length = 754 Score = 32.0 bits (71), Expect = 0.41 Identities = 14/29 (48%), Positives = 19/29 (65%) Frame = +3 Query: 6 QVRPSLDISVDPNLYSKRFVSFLERVFPE 92 Q P+ +VDP LYS+RF F+ R+F E Sbjct: 724 QADPASISAVDPKLYSRRFRDFISRIFIE 752
>PI5K4_ARATH (Q9M1K2) Putative phosphatidylinositol-4-phosphate 5-kinase 4 (EC| 2.7.1.68) (AtPIP5K4) (1-phosphatidylinositol-4-phosphate kinase 4) (PtdIns(4)P-5-kinase 4) (Diphosphoinositide kinase 4) Length = 779 Score = 30.8 bits (68), Expect = 0.90 Identities = 14/31 (45%), Positives = 20/31 (64%) Frame = +3 Query: 6 QVRPSLDISVDPNLYSKRFVSFLERVFPEQD 98 Q P+ +VDP LYS+RF F+ +VF E + Sbjct: 749 QYDPTSISAVDPRLYSRRFRDFIFKVFTEDN 779
>PI5K3_ARATH (O48709) Phosphatidylinositol-4-phosphate 5-kinase 3 (EC 2.7.1.68)| (AtPIP5K3) (1-phosphatidylinositol-4-phosphate kinase 3) (PtdIns(4)P-5-kinase 3) (Diphosphoinositide kinase 3) Length = 705 Score = 29.6 bits (65), Expect = 2.0 Identities = 12/26 (46%), Positives = 18/26 (69%) Frame = +3 Query: 15 PSLDISVDPNLYSKRFVSFLERVFPE 92 P+ +VDP LYS+RF F+ ++F E Sbjct: 678 PASISAVDPKLYSRRFRDFINKIFIE 703
>HIR2_YEAST (P32480) Histone transcription regulator 2| Length = 875 Score = 29.3 bits (64), Expect = 2.6 Identities = 15/38 (39%), Positives = 20/38 (52%) Frame = -2 Query: 245 VSFLELHKNYMCCLLSISSEYVHPLQQKQQQENKNTHY 132 +SFLE Y+ CL SI Y ++QK+ NT Y Sbjct: 594 ISFLEACGTYLLCLTSIGELYCWNIEQKKLAFPTNTIY 631
>PI5K6_ARATH (Q9SFB8) Phosphatidylinositol-4-phosphate 5-kinase 6 (EC 2.7.1.68)| (AtPIP5K6) (1-phosphatidylinositol-4-phosphate kinase 6) (PtdIns(4)P-5-kinase 6) (Diphosphoinositide kinase 6) Length = 715 Score = 28.9 bits (63), Expect = 3.4 Identities = 14/29 (48%), Positives = 18/29 (62%) Frame = +3 Query: 6 QVRPSLDISVDPNLYSKRFVSFLERVFPE 92 Q P+ +VDP YS+RF F+ RVF E Sbjct: 685 QYDPTSISAVDPKQYSRRFRDFIFRVFVE 713
>PI5K5_ARATH (Q9SLG9) Phosphatidylinositol-4-phosphate 5-kinase 5 (EC 2.7.1.68)| (AtPIP5K5) (1-phosphatidylinositol-4-phosphate kinase 5) (PtdIns(4)P-5-kinase 5) (Diphosphoinositide kinase 5) Length = 772 Score = 28.5 bits (62), Expect = 4.5 Identities = 13/31 (41%), Positives = 19/31 (61%) Frame = +3 Query: 6 QVRPSLDISVDPNLYSKRFVSFLERVFPEQD 98 Q PS +VDP YS+RF F+ +VF + + Sbjct: 742 QYDPSSISAVDPRQYSRRFRDFIFKVFTDDN 772
>PLS4_HUMAN (Q9NRQ2) Phospholipid scramblase 4 (PL scramblase 4)| (Ca(2+)-dependent phospholipid scramblase 4) (TRA1) Length = 329 Score = 27.3 bits (59), Expect = 10.0 Identities = 9/19 (47%), Positives = 11/19 (57%) Frame = +1 Query: 142 FLFSCCCFCCKG*TYSLEI 198 F +CCCFCC LE+ Sbjct: 193 FRCTCCCFCCPSARQELEV 211
>SPIKE_IBVM (P12651) Spike glycoprotein precursor (Peplomer protein) (E2)| [Contains: Spike protein S1; Spike protein S2] Length = 1162 Score = 27.3 bits (59), Expect = 10.0 Identities = 13/42 (30%), Positives = 19/42 (45%) Frame = +1 Query: 136 WVFLFSCCCFCCKG*TYSLEILNRQHM*FLCSSKKLTYCTGD 261 WVF + CC CC G + ++++ C K Y T D Sbjct: 1113 WVFFMTGCCGCCCGCFGIMPLMSK------CGKKSSYYTTFD 1148
>SPIKE_IBVK (P12650) Spike glycoprotein precursor (Peplomer protein) (E2)| [Contains: Spike protein S1; Spike protein S2] Length = 1162 Score = 27.3 bits (59), Expect = 10.0 Identities = 13/42 (30%), Positives = 19/42 (45%) Frame = +1 Query: 136 WVFLFSCCCFCCKG*TYSLEILNRQHM*FLCSSKKLTYCTGD 261 WVF + CC CC G + ++++ C K Y T D Sbjct: 1113 WVFFMTGCCGCCCGCFGIIPLMSK------CGKKSSYYTTFD 1148
>SPIKE_IBVB (P11223) Spike glycoprotein precursor (Peplomer protein) (E2)| [Contains: Spike protein S1; Spike protein S2] Length = 1162 Score = 27.3 bits (59), Expect = 10.0 Identities = 13/42 (30%), Positives = 19/42 (45%) Frame = +1 Query: 136 WVFLFSCCCFCCKG*TYSLEILNRQHM*FLCSSKKLTYCTGD 261 WVF + CC CC G + ++++ C K Y T D Sbjct: 1113 WVFFMTGCCGCCCGCFGIMPLMSK------CGKKSSYYTTFD 1148
>KC13_YEAST (P39962) Casein kinase I homolog 3 (EC 2.7.11.1)| Length = 524 Score = 27.3 bits (59), Expect = 10.0 Identities = 11/40 (27%), Positives = 18/40 (45%) Frame = +1 Query: 52 RNDSLVSWRGFSLSKTKIREAVNST*Q*WVFLFSCCCFCC 171 +N + S R + + N T ++ + CCCFCC Sbjct: 484 KNINYQSQRNYEQENDAYSDDENDTFCSKIYKYCCCCFCC 523 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 42,510,362 Number of Sequences: 219361 Number of extensions: 769048 Number of successful extensions: 2046 Number of sequences better than 10.0: 16 Number of HSP's better than 10.0 without gapping: 2001 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2042 length of database: 80,573,946 effective HSP length: 78 effective length of database: 63,463,788 effective search space used: 1523130912 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)