Clone Name | basd2k20 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | E41LA_HUMAN (Q9HCS5) Band 4.1-like protein 4A (NBL4 protein) | 29 | 3.0 | 2 | FAEB_ASPNG (Q8WZI8) Feruloyl esterase B precursor (EC 3.1.1.73) ... | 28 | 5.1 | 3 | YR01_CAEEL (Q10014) Hypothetical protein T25E4.1 precursor | 28 | 5.1 | 4 | ALS2_MOUSE (Q920R0) Alsin (Amyotrophic lateral sclerosis protein... | 28 | 8.7 |
---|
>E41LA_HUMAN (Q9HCS5) Band 4.1-like protein 4A (NBL4 protein)| Length = 598 Score = 29.3 bits (64), Expect = 3.0 Identities = 16/54 (29%), Positives = 27/54 (50%) Frame = -1 Query: 176 RSPRFGSISSDNRPIKTRFRYGSGGFRSLNQATAYESPAHSSTGTRSEITFPSH 15 R+P GS + +P++ R + SG L Q S ++S+G+ SE + H Sbjct: 443 RNPSCGSDNDSVQPVRRRKAHNSGEDSDLKQRRRSRSRCNTSSGSESENSNREH 496
>FAEB_ASPNG (Q8WZI8) Feruloyl esterase B precursor (EC 3.1.1.73) (Ferulic acid| esterase B) (FAEB) (FAE-I) (Cinnamoyl esterase) (CinnAE) Length = 521 Score = 28.5 bits (62), Expect = 5.1 Identities = 15/42 (35%), Positives = 19/42 (45%) Frame = +3 Query: 39 PRAC*RMSRRLIGSGLVKGTEPTGAVAKASLNRAIVTAYGPE 164 P C + RLI G GT A +NRA+ YGP+ Sbjct: 267 PDFCAPVIERLICDGTTNGTSCITGAQAAKVNRALSDFYGPD 308
>YR01_CAEEL (Q10014) Hypothetical protein T25E4.1 precursor| Length = 231 Score = 28.5 bits (62), Expect = 5.1 Identities = 13/34 (38%), Positives = 20/34 (58%) Frame = -2 Query: 157 P*AVTIALLRLAFATAPVGSVPLTKPLPMSRRLI 56 P A AL+R AFA PV + P P+P++ ++ Sbjct: 55 PVAAAPALVRPAFAPVPVAAAPAFAPVPVAAPMV 88
>ALS2_MOUSE (Q920R0) Alsin (Amyotrophic lateral sclerosis protein 2 homolog)| Length = 1651 Score = 27.7 bits (60), Expect = 8.7 Identities = 16/45 (35%), Positives = 21/45 (46%), Gaps = 2/45 (4%) Frame = -2 Query: 136 LLRLAFATAPV--GSVPLTKPLPMSRRLILQQARGQRSLSPPTGW 8 L+R F P ++PL+ PLP RR RS SP G+ Sbjct: 1419 LVRFLFPELPEEGSTIPLSAPLPTGRRSFCTGKSDSRSESPEPGY 1463 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 30,543,910 Number of Sequences: 219361 Number of extensions: 502899 Number of successful extensions: 1338 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1210 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1336 length of database: 80,573,946 effective HSP length: 38 effective length of database: 72,238,228 effective search space used: 1733717472 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)