Clone Name | basd2k07 |
---|---|
Clone Library Name | barley_pub |
>PI5K1_ORYSA (Q6EX42) Phosphatidylinositol-4-phosphate 5-kinase 1 precursor (EC| 2.7.1.68) (1-phosphatidylinositol-4-phosphate kinase) (PIP5K) (PtdIns(4)P-5-kinase) (Diphosphoinositide kinase) Length = 801 Score = 63.9 bits (154), Expect = 1e-10 Identities = 28/33 (84%), Positives = 33/33 (100%) Frame = +1 Query: 1 ALKFDPLSISSVDPNLYSKRFVSFLERVFPEQD 99 +LKFDPLSIS+VDPNLYS+RF+SFLE+VFPEQD Sbjct: 769 SLKFDPLSISAVDPNLYSRRFISFLEKVFPEQD 801
>PI5K8_ARATH (Q8RY89) Phosphatidylinositol-4-phosphate 5-kinase 8 (EC 2.7.1.68)| (AtPIP5K8) (1-phosphatidylinositol-4-phosphate kinase 8) (PtdIns(4)P-5-kinase 8) (Diphosphoinositide kinase 8) Length = 769 Score = 48.5 bits (114), Expect = 4e-06 Identities = 18/32 (56%), Positives = 29/32 (90%) Frame = +1 Query: 1 ALKFDPLSISSVDPNLYSKRFVSFLERVFPEQ 96 ++K+DP++IS+++P LYSKRF+ FL +VFPE+ Sbjct: 737 SMKYDPMTISAIEPTLYSKRFIDFLLKVFPEK 768
>PI5K7_ARATH (Q9SUI2) Phosphatidylinositol-4-phosphate 5-kinase 7 (EC 2.7.1.68)| (AtPIP5K7) (1-phosphatidylinositol-4-phosphate kinase 7) (PtdIns(4)P-5-kinase 7) (Diphosphoinositide kinase 7) (AtP5K2) Length = 754 Score = 46.2 bits (108), Expect = 2e-05 Identities = 18/32 (56%), Positives = 28/32 (87%) Frame = +1 Query: 1 ALKFDPLSISSVDPNLYSKRFVSFLERVFPEQ 96 +L++DP++IS +P+ YSKRFV+FL +VFPE+ Sbjct: 722 SLQYDPMTISVTEPSTYSKRFVNFLHKVFPEE 753
>PI5K9_ARATH (Q8L850) Phosphatidylinositol-4-phosphate 5-kinase 9 (EC 2.7.1.68)| (AtPIP5K9) (1-phosphatidylinositol-4-phosphate kinase 9) (PtdIns(4)P-5-kinase 9) (Diphosphoinositide kinase 9) Length = 815 Score = 44.7 bits (104), Expect = 6e-05 Identities = 18/33 (54%), Positives = 27/33 (81%) Frame = +1 Query: 1 ALKFDPLSISSVDPNLYSKRFVSFLERVFPEQD 99 +L FD LSIS+VDP YS+RF+ F+++VFP+ + Sbjct: 781 SLHFDSLSISAVDPTFYSQRFLEFIKKVFPQNN 813
>PI5K1_ARATH (Q56YP2) Phosphatidylinositol-4-phosphate 5-kinase 1 (EC 2.7.1.68)| (AtPIP5K1) (1-phosphatidylinositol-4-phosphate kinase 1) (PtdIns(4)P-5-kinase 1) (Diphosphoinositide kinase 1) Length = 752 Score = 43.1 bits (100), Expect = 2e-04 Identities = 19/32 (59%), Positives = 25/32 (78%) Frame = +1 Query: 1 ALKFDPLSISSVDPNLYSKRFVSFLERVFPEQ 96 +L+ DP SIS+VDP LYSKRF F+ R+F E+ Sbjct: 720 SLQADPASISAVDPKLYSKRFRDFISRIFIEE 751
>PI5K4_ARATH (Q9M1K2) Putative phosphatidylinositol-4-phosphate 5-kinase 4 (EC| 2.7.1.68) (AtPIP5K4) (1-phosphatidylinositol-4-phosphate kinase 4) (PtdIns(4)P-5-kinase 4) (Diphosphoinositide kinase 4) Length = 779 Score = 41.6 bits (96), Expect = 5e-04 Identities = 17/33 (51%), Positives = 26/33 (78%) Frame = +1 Query: 1 ALKFDPLSISSVDPNLYSKRFVSFLERVFPEQD 99 ++++DP SIS+VDP LYS+RF F+ +VF E + Sbjct: 747 SIQYDPTSISAVDPRLYSRRFRDFIFKVFTEDN 779
>PI5K2_ARATH (Q8L796) Phosphatidylinositol-4-phosphate 5-kinase 2 (EC 2.7.1.68)| (AtPIP5K2) (1-phosphatidylinositol-4-phosphate kinase 2) (PtdIns(4)P-5-kinase 2) (Diphosphoinositide kinase 2) Length = 754 Score = 41.2 bits (95), Expect = 7e-04 Identities = 18/31 (58%), Positives = 24/31 (77%) Frame = +1 Query: 1 ALKFDPLSISSVDPNLYSKRFVSFLERVFPE 93 +L+ DP SIS+VDP LYS+RF F+ R+F E Sbjct: 722 SLQADPASISAVDPKLYSRRFRDFISRIFIE 752
>PI5K6_ARATH (Q9SFB8) Phosphatidylinositol-4-phosphate 5-kinase 6 (EC 2.7.1.68)| (AtPIP5K6) (1-phosphatidylinositol-4-phosphate kinase 6) (PtdIns(4)P-5-kinase 6) (Diphosphoinositide kinase 6) Length = 715 Score = 39.7 bits (91), Expect = 0.002 Identities = 17/31 (54%), Positives = 24/31 (77%) Frame = +1 Query: 1 ALKFDPLSISSVDPNLYSKRFVSFLERVFPE 93 ++++DP SIS+VDP YS+RF F+ RVF E Sbjct: 683 SMQYDPTSISAVDPKQYSRRFRDFIFRVFVE 713
>PI5K3_ARATH (O48709) Phosphatidylinositol-4-phosphate 5-kinase 3 (EC 2.7.1.68)| (AtPIP5K3) (1-phosphatidylinositol-4-phosphate kinase 3) (PtdIns(4)P-5-kinase 3) (Diphosphoinositide kinase 3) Length = 705 Score = 39.3 bits (90), Expect = 0.003 Identities = 17/31 (54%), Positives = 23/31 (74%) Frame = +1 Query: 1 ALKFDPLSISSVDPNLYSKRFVSFLERVFPE 93 +L DP SIS+VDP LYS+RF F+ ++F E Sbjct: 673 SLHADPASISAVDPKLYSRRFRDFINKIFIE 703
>PI5K5_ARATH (Q9SLG9) Phosphatidylinositol-4-phosphate 5-kinase 5 (EC 2.7.1.68)| (AtPIP5K5) (1-phosphatidylinositol-4-phosphate kinase 5) (PtdIns(4)P-5-kinase 5) (Diphosphoinositide kinase 5) Length = 772 Score = 37.7 bits (86), Expect = 0.007 Identities = 15/33 (45%), Positives = 25/33 (75%) Frame = +1 Query: 1 ALKFDPLSISSVDPNLYSKRFVSFLERVFPEQD 99 ++++DP SIS+VDP YS+RF F+ +VF + + Sbjct: 740 SIQYDPSSISAVDPRQYSRRFRDFIFKVFTDDN 772
>PI5KB_ARATH (Q9M149) Putative phosphatidylinositol-4-phosphate 5-kinase 11 (EC| 2.7.1.68) (AtPIP5K11) (1-phosphatidylinositol-4-phosphate kinase 11) (PtdIns(4)P-5-kinase 11) (Diphosphoinositide kinase 11) Length = 401 Score = 30.4 bits (67), Expect = 1.2 Identities = 12/33 (36%), Positives = 21/33 (63%) Frame = +1 Query: 1 ALKFDPLSISSVDPNLYSKRFVSFLERVFPEQD 99 +++++ SIS+V P +YS RF F+ +F D Sbjct: 362 SIQYNSNSISTVHPKIYSSRFQDFVSNIFLPHD 394
>HIR2_YEAST (P32480) Histone transcription regulator 2| Length = 875 Score = 29.3 bits (64), Expect = 2.6 Identities = 15/38 (39%), Positives = 20/38 (52%) Frame = -2 Query: 246 VSFLELHKNYMCCLLSISSEYVHPLQQKQQQENKNTHY 133 +SFLE Y+ CL SI Y ++QK+ NT Y Sbjct: 594 ISFLEACGTYLLCLTSIGELYCWNIEQKKLAFPTNTIY 631
>PLS4_HUMAN (Q9NRQ2) Phospholipid scramblase 4 (PL scramblase 4)| (Ca(2+)-dependent phospholipid scramblase 4) (TRA1) Length = 329 Score = 27.3 bits (59), Expect = 10.0 Identities = 9/19 (47%), Positives = 11/19 (57%) Frame = +2 Query: 143 FLFSCCCFCCKG*TYSLEI 199 F +CCCFCC LE+ Sbjct: 193 FRCTCCCFCCPSARQELEV 211
>SPIKE_IBVM (P12651) Spike glycoprotein precursor (Peplomer protein) (E2)| [Contains: Spike protein S1; Spike protein S2] Length = 1162 Score = 27.3 bits (59), Expect = 10.0 Identities = 13/42 (30%), Positives = 19/42 (45%) Frame = +2 Query: 137 WVFLFSCCCFCCKG*TYSLEILNRQHM*FLCSSKKLTYCTGD 262 WVF + CC CC G + ++++ C K Y T D Sbjct: 1113 WVFFMTGCCGCCCGCFGIMPLMSK------CGKKSSYYTTFD 1148
>SPIKE_IBVK (P12650) Spike glycoprotein precursor (Peplomer protein) (E2)| [Contains: Spike protein S1; Spike protein S2] Length = 1162 Score = 27.3 bits (59), Expect = 10.0 Identities = 13/42 (30%), Positives = 19/42 (45%) Frame = +2 Query: 137 WVFLFSCCCFCCKG*TYSLEILNRQHM*FLCSSKKLTYCTGD 262 WVF + CC CC G + ++++ C K Y T D Sbjct: 1113 WVFFMTGCCGCCCGCFGIIPLMSK------CGKKSSYYTTFD 1148
>SPIKE_IBVB (P11223) Spike glycoprotein precursor (Peplomer protein) (E2)| [Contains: Spike protein S1; Spike protein S2] Length = 1162 Score = 27.3 bits (59), Expect = 10.0 Identities = 13/42 (30%), Positives = 19/42 (45%) Frame = +2 Query: 137 WVFLFSCCCFCCKG*TYSLEILNRQHM*FLCSSKKLTYCTGD 262 WVF + CC CC G + ++++ C K Y T D Sbjct: 1113 WVFFMTGCCGCCCGCFGIMPLMSK------CGKKSSYYTTFD 1148
>SDHD_BACHK (Q6HKG3) Probable D-serine dehydratase (EC 4.3.1.18) (D-serine| deaminase) (DSD) Length = 446 Score = 27.3 bits (59), Expect = 10.0 Identities = 15/32 (46%), Positives = 20/32 (62%), Gaps = 1/32 (3%) Frame = +1 Query: 1 ALKFDPLSISSV-DPNLYSKRFVSFLERVFPE 93 A+K PLS +V D KRF S++ +VFPE Sbjct: 36 AIKDSPLSEENVKDAEERLKRFASYIAKVFPE 67
>SDHD_BACCZ (Q63D23) Probable D-serine dehydratase (EC 4.3.1.18) (D-serine| deaminase) (DSD) Length = 446 Score = 27.3 bits (59), Expect = 10.0 Identities = 15/32 (46%), Positives = 20/32 (62%), Gaps = 1/32 (3%) Frame = +1 Query: 1 ALKFDPLSISSV-DPNLYSKRFVSFLERVFPE 93 A+K PLS +V D KRF S++ +VFPE Sbjct: 36 AIKDSPLSEENVKDAEERLKRFASYIAKVFPE 67
>SDHD_BACAN (Q81S85) Probable D-serine dehydratase (EC 4.3.1.18) (D-serine| deaminase) (DSD) Length = 446 Score = 27.3 bits (59), Expect = 10.0 Identities = 15/32 (46%), Positives = 20/32 (62%), Gaps = 1/32 (3%) Frame = +1 Query: 1 ALKFDPLSISSV-DPNLYSKRFVSFLERVFPE 93 A+K PLS +V D KRF S++ +VFPE Sbjct: 36 AIKDSPLSEENVKDAEERLKRFASYIAKVFPE 67
>KC13_YEAST (P39962) Casein kinase I homolog 3 (EC 2.7.11.1)| Length = 524 Score = 27.3 bits (59), Expect = 10.0 Identities = 11/40 (27%), Positives = 18/40 (45%) Frame = +2 Query: 53 RNDSLVSWRGFSLSKTKIREAVNST*Q*WVFLFSCCCFCC 172 +N + S R + + N T ++ + CCCFCC Sbjct: 484 KNINYQSQRNYEQENDAYSDDENDTFCSKIYKYCCCCFCC 523 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 42,550,948 Number of Sequences: 219361 Number of extensions: 770321 Number of successful extensions: 1995 Number of sequences better than 10.0: 20 Number of HSP's better than 10.0 without gapping: 1949 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1991 length of database: 80,573,946 effective HSP length: 78 effective length of database: 63,463,788 effective search space used: 1523130912 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)