| Clone Name | basd2j15 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | PPSA_AERPE (Q9YEC5) Phosphoenolpyruvate synthase (EC 2.7.9.2) (P... | 30 | 1.1 | 2 | MUC1_MOUSE (Q02496) Mucin-1 precursor (Polymorphic epithelial mu... | 27 | 9.1 | 3 | TRPE_AZOBR (P50872) Anthranilate synthase (EC 4.1.3.27) [Include... | 27 | 9.1 |
|---|
>PPSA_AERPE (Q9YEC5) Phosphoenolpyruvate synthase (EC 2.7.9.2) (Pyruvate, water| dikinase) (PEP synthase) Length = 845 Score = 30.4 bits (67), Expect = 1.1 Identities = 18/46 (39%), Positives = 25/46 (54%), Gaps = 3/46 (6%) Frame = +3 Query: 234 DPDYEQGETLLWEASGSPLIPLSEFSHPSVAK---KYGVKPDAETL 362 DPD + + SG L L HP+VA+ KYG++PDA +L Sbjct: 283 DPDLNENVEIKIPESGEELEDLRR-KHPAVAEVVEKYGIRPDAPSL 327
>MUC1_MOUSE (Q02496) Mucin-1 precursor (Polymorphic epithelial mucin) (PEMT)| (Episialin) Length = 630 Score = 27.3 bits (59), Expect = 9.1 Identities = 14/42 (33%), Positives = 21/42 (50%) Frame = +3 Query: 258 TLLWEASGSPLIPLSEFSHPSVAKKYGVKPDAETLDMLNTIA 383 +L++ S P+S + PSV +Y V P T +TIA Sbjct: 351 SLVYNTSAIATTPVSNGTQPSVPSQYPVSPTMATTSSHSTIA 392
>TRPE_AZOBR (P50872) Anthranilate synthase (EC 4.1.3.27) [Includes: Glutamine| amidotransferase] Length = 732 Score = 27.3 bits (59), Expect = 9.1 Identities = 13/34 (38%), Positives = 21/34 (61%) Frame = -3 Query: 181 AAHCSAARLPSEKSTARPTHLSPSAAMVDLFSLP 80 A+ S A LP E+ + +P+ S A++DLF+ P Sbjct: 123 ASSASPAPLPGEERSRQPSVFSVLRAVLDLFAAP 156 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 31,545,752 Number of Sequences: 219361 Number of extensions: 393042 Number of successful extensions: 1207 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1193 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1207 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 1391514312 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)