| Clone Name | basd2i04 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | PTM1_YEAST (P32857) Protein PTM1 precursor | 29 | 3.5 | 2 | COX10_YARLI (Q6C0L2) Protoheme IX farnesyltransferase, mitochond... | 28 | 7.9 | 3 | ALEUL_ARATH (Q8RWQ9) Thiol protease aleurain-like precursor (EC ... | 28 | 7.9 |
|---|
>PTM1_YEAST (P32857) Protein PTM1 precursor| Length = 531 Score = 28.9 bits (63), Expect = 3.5 Identities = 16/40 (40%), Positives = 22/40 (55%), Gaps = 1/40 (2%) Frame = -2 Query: 283 FFFLLTIAIFISIT-PQLNQTNREQTPTLAALQVSICVAF 167 FF LL IA+ I P+LN+T + AL +IC+ F Sbjct: 280 FFLLLIIALGYGIVYPKLNKTLMRRCQMYGALTYAICIGF 319
>COX10_YARLI (Q6C0L2) Protoheme IX farnesyltransferase, mitochondrial precursor| (EC 2.5.1.-) (Heme O synthase) Length = 471 Score = 27.7 bits (60), Expect = 7.9 Identities = 15/49 (30%), Positives = 26/49 (53%), Gaps = 3/49 (6%) Frame = -1 Query: 212 NPNIGSLAGLNMRGLSFQLCI-IQFASI--YWFLFNSFANN*LID*WAF 75 NP + + GL L F LC+ + + ++ +WF+ +S N + WAF Sbjct: 355 NPGLNARVGLRYALLMFPLCVGLSYYNVTDWWFVLDSSVLNAWMAWWAF 403
>ALEUL_ARATH (Q8RWQ9) Thiol protease aleurain-like precursor (EC 3.4.22.16)| Length = 358 Score = 27.7 bits (60), Expect = 7.9 Identities = 11/33 (33%), Positives = 19/33 (57%) Frame = -1 Query: 206 NIGSLAGLNMRGLSFQLCIIQFASIYWFLFNSF 108 N+ + N +GLS++L + QFA + W F + Sbjct: 86 NLDLIRSTNKKGLSYKLSLNQFADLTWQEFQRY 118 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 38,644,849 Number of Sequences: 219361 Number of extensions: 646044 Number of successful extensions: 1168 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1160 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1168 length of database: 80,573,946 effective HSP length: 70 effective length of database: 65,218,676 effective search space used: 1565248224 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)