Clone Name | basd2h22 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | CU24_ARADI (P80516) Adult-specific rigid cuticular protein 12.4 ... | 32 | 1.4 | 2 | DHX34_MOUSE (Q9DBV3) Probable ATP-dependent RNA helicase DHX34 (... | 31 | 3.2 | 3 | GUAA_SYNPX (Q7UA53) GMP synthase [glutamine-hydrolyzing] (EC 6.3... | 30 | 4.2 | 4 | OPPA_ECOLI (P23843) Periplasmic oligopeptide-binding protein pre... | 29 | 9.4 |
---|
>CU24_ARADI (P80516) Adult-specific rigid cuticular protein 12.4 (ACP 12.4)| Length = 126 Score = 32.0 bits (71), Expect = 1.4 Identities = 15/39 (38%), Positives = 17/39 (43%) Frame = +1 Query: 229 MLCGEGVYSQSFNNNGIIAHSRVASGCVGPVIDDYIYGD 345 M G Y+ FN HSRV SG G + Y Y D Sbjct: 5 MTLAGGAYNFGFNTGDATGHSRVESGTAGSAVGSYSYID 43
>DHX34_MOUSE (Q9DBV3) Probable ATP-dependent RNA helicase DHX34 (EC 3.6.1.-)| (DEAH box protein 34) Length = 1145 Score = 30.8 bits (68), Expect = 3.2 Identities = 20/73 (27%), Positives = 32/73 (43%) Frame = -1 Query: 262 MTVNTPLLRIASSQTRCRAHGNSPLLGVQSYYHGTHSTCNVFLQCLEVSRSQDSTSAPWC 83 ++V +P R A S C A PL +S + NVF ++V + S WC Sbjct: 614 LSVQSPFTRSAQSNLDC-ATARRPL---ESDQGDPFTLFNVFNAWVQVKSERSGNSRKWC 669 Query: 82 HRWDIQQRRALEV 44 R +++ R E+ Sbjct: 670 RRRGVEEHRLYEM 682
>GUAA_SYNPX (Q7UA53) GMP synthase [glutamine-hydrolyzing] (EC 6.3.5.2)| (Glutamine amidotransferase) (GMP synthetase) Length = 528 Score = 30.4 bits (67), Expect = 4.2 Identities = 22/56 (39%), Positives = 26/56 (46%) Frame = -1 Query: 301 LPHGCVR*SHCC*MTVNTPLLRIASSQTRCRAHGNSPLLGVQSYYHGTHSTCNVFL 134 LP G VR +H T NTP +A Q R L GVQ + HSTC + L Sbjct: 147 LPEGFVRLAH----TANTPEAAVAHLQRR--------LYGVQFHPEVVHSTCGMAL 190
>OPPA_ECOLI (P23843) Periplasmic oligopeptide-binding protein precursor| Length = 543 Score = 29.3 bits (64), Expect = 9.4 Identities = 23/71 (32%), Positives = 33/71 (46%), Gaps = 4/71 (5%) Frame = -3 Query: 215 MSRPRKLSLVGCAILLPWYSQYMQRVSSVPGGVTLTGQHKRTLVPSLGHSAKK----SIG 48 M+ K SLV +L + + + VP GVTL K+TLV + G + I Sbjct: 1 MTNITKRSLVAAGVLAALMAGNVALAADVPAGVTLA--EKQTLVRNNGSEVQSLDPHKIE 58 Query: 47 GVPAEWVARKL 15 GVP ++R L Sbjct: 59 GVPESNISRDL 69 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 92,915,581 Number of Sequences: 219361 Number of extensions: 1989295 Number of successful extensions: 4901 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4668 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4896 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 5424720305 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)