Clone Name | basd2h06 |
---|---|
Clone Library Name | barley_pub |
>NLT43_HORVU (Q42842) Nonspecific lipid-transfer protein 4.3 precursor (LTP 4.3)| Length = 115 Score = 32.0 bits (71), Expect = 0.45 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = +2 Query: 2 PYAISASVDCSKIR 43 PYAISASVDCSKIR Sbjct: 102 PYAISASVDCSKIR 115
>NLT42_HORVU (Q43875) Nonspecific lipid-transfer protein 4.2 precursor (LTP 4.2)| (Low-temperature-responsive protein 4.9) Length = 115 Score = 32.0 bits (71), Expect = 0.45 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = +2 Query: 2 PYAISASVDCSKIR 43 PYAISASVDCSKIR Sbjct: 102 PYAISASVDCSKIR 115
>NLT41_HORVU (Q43767) Nonspecific lipid-transfer protein 4.1 precursor (LTP 4.1)| (CW21) (CW-21) Length = 115 Score = 32.0 bits (71), Expect = 0.45 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = +2 Query: 2 PYAISASVDCSKIR 43 PYAISASVDCSKIR Sbjct: 102 PYAISASVDCSKIR 115
>SPT6H_CAEEL (P34703) Suppressor of Ty 6 homolog (Abnormal embryogenesis protein| 5) Length = 1521 Score = 29.6 bits (65), Expect = 2.2 Identities = 16/46 (34%), Positives = 22/46 (47%), Gaps = 1/46 (2%) Frame = +1 Query: 64 IAPAIDAEYVEVTHTYIYMN-KCSHIIFMWDIYRERQRERGRSIYV 198 + P I + TH Y + N C + RE++RE GRS YV Sbjct: 1384 VQPMIQISHEITTHKYFFPNGTCEETEAVEQFVREKKRELGRSPYV 1429
>NLTP8_HORVU (Q43871) Nonspecific lipid-transfer protein Cw18 precursor (LTP| Cw-18) (PKG2316) Length = 115 Score = 28.5 bits (62), Expect = 5.0 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +2 Query: 2 PYAISASVDCSKI 40 PY ISASVDCSKI Sbjct: 102 PYTISASVDCSKI 114
>NLTP_ELECO (P23802) Nonspecific lipid-transfer protein (LTP) (Alpha-amylase| inhibitor I-2) Length = 95 Score = 28.1 bits (61), Expect = 6.5 Identities = 10/13 (76%), Positives = 13/13 (100%) Frame = +2 Query: 2 PYAISASVDCSKI 40 PYAISAS+DCS++ Sbjct: 81 PYAISASIDCSRV 93 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 26,858,903 Number of Sequences: 219361 Number of extensions: 424055 Number of successful extensions: 1043 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 1028 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1042 length of database: 80,573,946 effective HSP length: 47 effective length of database: 70,263,979 effective search space used: 1686335496 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)