| Clone Name | basd2h01 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | PQN25_CAEEL (P41951) Glutamine/asparagine-rich protein pqn-25 | 28 | 5.9 | 2 | PARP2_HUMAN (Q9UGN5) Poly [ADP-ribose] polymerase 2 (EC 2.4.2.30... | 28 | 7.8 |
|---|
>PQN25_CAEEL (P41951) Glutamine/asparagine-rich protein pqn-25| Length = 672 Score = 28.1 bits (61), Expect = 5.9 Identities = 17/56 (30%), Positives = 24/56 (42%), Gaps = 8/56 (14%) Frame = +2 Query: 17 CMVMHKHT*YICVYELNLYLGTNS--------EINTCSSTRSEGAAHVFCLNSQVC 160 C + YIC Y N G+NS ++ TC ST ++ A+ C N C Sbjct: 90 CQYASTYNNYICCYSTNTQCGSNSSPQVSASGQVVTC-STNTQCASGYTCNNGACC 144
>PARP2_HUMAN (Q9UGN5) Poly [ADP-ribose] polymerase 2 (EC 2.4.2.30) (PARP-2)| (NAD(+) ADP-ribosyltransferase 2) (Poly[ADP-ribose] synthetase 2) (pADPRT-2) (hPARP-2) Length = 583 Score = 27.7 bits (60), Expect = 7.8 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = +2 Query: 110 TRSEGAAHVFCLNSQVCDMLLGMHKTSFNSVK 205 T G AHV+C + V D++L FN+ K Sbjct: 99 TAKVGKAHVYCEGNDVYDVMLNQTNLQFNNNK 130 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 37,606,757 Number of Sequences: 219361 Number of extensions: 584207 Number of successful extensions: 1141 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1134 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1141 length of database: 80,573,946 effective HSP length: 74 effective length of database: 64,341,232 effective search space used: 1544189568 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)