Clone Name | basd2f01 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | E75BB_DROME (P13055) Ecdysone-induced protein 75B isoform B (E75-C) | 30 | 1.2 | 2 | E75BA_DROME (P17672) Ecdysone-induced protein 75B isoform A (E75-B) | 30 | 1.2 | 3 | E75BC_DROME (P17671) Ecdysone-induced protein 75B isoforms C/D (... | 30 | 1.2 |
---|
>E75BB_DROME (P13055) Ecdysone-induced protein 75B isoform B (E75-C)| Length = 1412 Score = 30.4 bits (67), Expect = 1.2 Identities = 17/44 (38%), Positives = 21/44 (47%) Frame = +3 Query: 42 SVHLPLSTGMEQQPEEVSLPSDPTHAKSDKISASNLLAGLFKGG 173 S L + QP+ VSLPS P S S++ LLA GG Sbjct: 848 SADLDYGSPSSSQPQGVSLPSPPQQQPSALASSAPLLAATLSGG 891
>E75BA_DROME (P17672) Ecdysone-induced protein 75B isoform A (E75-B)| Length = 1355 Score = 30.4 bits (67), Expect = 1.2 Identities = 17/44 (38%), Positives = 21/44 (47%) Frame = +3 Query: 42 SVHLPLSTGMEQQPEEVSLPSDPTHAKSDKISASNLLAGLFKGG 173 S L + QP+ VSLPS P S S++ LLA GG Sbjct: 791 SADLDYGSPSSSQPQGVSLPSPPQQQPSALASSAPLLAATLSGG 834
>E75BC_DROME (P17671) Ecdysone-induced protein 75B isoforms C/D (E75-A)| Length = 1199 Score = 30.4 bits (67), Expect = 1.2 Identities = 17/44 (38%), Positives = 21/44 (47%) Frame = +3 Query: 42 SVHLPLSTGMEQQPEEVSLPSDPTHAKSDKISASNLLAGLFKGG 173 S L + QP+ VSLPS P S S++ LLA GG Sbjct: 635 SADLDYGSPSSSQPQGVSLPSPPQQQPSALASSAPLLAATLSGG 678 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 43,878,760 Number of Sequences: 219361 Number of extensions: 822322 Number of successful extensions: 2038 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2002 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2038 length of database: 80,573,946 effective HSP length: 70 effective length of database: 65,218,676 effective search space used: 1565248224 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)