Clone Name | basd2e08 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | SUBF_BACSU (P16397) Bacillopeptidase F precursor (EC 3.4.21.-) (... | 31 | 1.0 | 2 | COTD_BACSU (P07791) Spore coat protein D | 28 | 6.7 |
---|
>SUBF_BACSU (P16397) Bacillopeptidase F precursor (EC 3.4.21.-) (Esterase)| (RP-I protease) (90 kDa serine proteinase) Length = 1433 Score = 30.8 bits (68), Expect = 1.0 Identities = 17/55 (30%), Positives = 26/55 (47%) Frame = +1 Query: 13 DTVDTVVKWKLSYDSHGNVVRKVRVGGEFDSNSDSGRDDKLEPKWRAQNRFSPSE 177 D +D W L YD G VV + G E++ + L+ K+R N +P+E Sbjct: 204 DQIDAPKAWALGYDGTGTVVASIDTGVEWNHPA-------LKEKYRGYNPENPNE 251
>COTD_BACSU (P07791) Spore coat protein D| Length = 75 Score = 28.1 bits (61), Expect = 6.7 Identities = 11/25 (44%), Positives = 13/25 (52%) Frame = -1 Query: 139 VPICHPFHCLNLNQIHHQREPFLPH 65 VP HP H N+N H Q + PH Sbjct: 29 VPHIHPQHTTNVNHQHFQHVHYFPH 53 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.310 0.130 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 29,689,428 Number of Sequences: 219361 Number of extensions: 495191 Number of successful extensions: 1164 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1156 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1164 length of database: 80,573,946 effective HSP length: 35 effective length of database: 72,896,311 effective search space used: 1749511464 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.7 bits)