Clone Name | basd2e02 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | YP74_CAEEL (Q09221) Hypothetical protein B0228.4 | 80 | 1e-15 | 2 | SYA_MYCGA (Q7NBY8) Alanyl-tRNA synthetase (EC 6.1.1.7) (Alanine-... | 28 | 5.0 | 3 | KRA45_HUMAN (Q9BYR2) Keratin-associated protein 4-5 (Keratin-ass... | 28 | 8.5 | 4 | RPOC2_PSEAK (Q3ZJ90) DNA-directed RNA polymerase beta'' chain (E... | 28 | 8.5 | 5 | ADO2_ARATH (Q8W420) Adagio protein 2 (LOV kelch protein 2) (Flav... | 28 | 8.5 |
---|
>YP74_CAEEL (Q09221) Hypothetical protein B0228.4| Length = 1633 Score = 80.5 bits (197), Expect = 1e-15 Identities = 41/68 (60%), Positives = 49/68 (72%) Frame = +3 Query: 3 GTRDGPWDMMHKFDDNIPARSFDNFQFVNFTEIMSKSIAADRKEAEFALSALMEIPTQYK 182 G DGPW+MM +FDDNIP R FDNF FV+F ++M + AD A FAL+ALMEIP QYK Sbjct: 1563 GVGDGPWNMMGRFDDNIPKRLFDNFHFVDFHKVMFNAPNAD---ASFALNALMEIPDQYK 1619 Query: 183 ATLDLQLL 206 A +L LL Sbjct: 1620 AIKELGLL 1627
>SYA_MYCGA (Q7NBY8) Alanyl-tRNA synthetase (EC 6.1.1.7) (Alanine--tRNA ligase)| (AlaRS) Length = 902 Score = 28.5 bits (62), Expect = 5.0 Identities = 17/53 (32%), Positives = 26/53 (49%) Frame = +3 Query: 48 NIPARSFDNFQFVNFTEIMSKSIAADRKEAEFALSALMEIPTQYKATLDLQLL 206 NI F+N N+TE++ K+I FA L ++PT Y L L ++ Sbjct: 204 NIVFSQFNNTGNNNYTELLRKNIDTGASLERFA-CILQDVPTNYDTDLYLPII 255
>KRA45_HUMAN (Q9BYR2) Keratin-associated protein 4-5 (Keratin-associated protein| 4.5) (Ultrahigh sulfur keratin-associated protein 4.5) Length = 186 Score = 27.7 bits (60), Expect = 8.5 Identities = 9/19 (47%), Positives = 11/19 (57%) Frame = -2 Query: 60 EPVCCRQTYASYPMVHPSC 4 +P CCR +Y HPSC Sbjct: 122 QPTCCRPSYCISSCCHPSC 140
>RPOC2_PSEAK (Q3ZJ90) DNA-directed RNA polymerase beta'' chain (EC 2.7.7.6)| (PEP) (Plastid-encoded RNA polymerase beta'' subunit) (RNA polymerase beta'' subunit) Length = 3462 Score = 27.7 bits (60), Expect = 8.5 Identities = 17/60 (28%), Positives = 29/60 (48%) Frame = -1 Query: 187 VALYCVGISINADNANSASFLSAAMLFDIISVKFTNWKLSNDRAGMLSSNLCIISHGPSL 8 + Y G++ A N N +F + A+L + + ++ N L DR+ +N I PSL Sbjct: 633 ILFYDFGVNSLAKNLNKNAFFNLALLNEQLYLRKGNLFLMQDRSTQKKANRSTIKILPSL 692
>ADO2_ARATH (Q8W420) Adagio protein 2 (LOV kelch protein 2) (Flavin-binding| kelch repeat F-box protein 1-like protein 1) (FKF1-like protein 1) (F-box only protein 2c) (FBX2c) Length = 611 Score = 27.7 bits (60), Expect = 8.5 Identities = 15/45 (33%), Positives = 23/45 (51%) Frame = -1 Query: 208 PRSWRSSVALYCVGISINADNANSASFLSAAMLFDIISVKFTNWK 74 PRSW SS L + ++ A+S + LS L D +S+ W+ Sbjct: 397 PRSWHSSCTLDGTKLIVSGGCADSGALLSDTFLLD-LSMDIPAWR 440 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 29,453,059 Number of Sequences: 219361 Number of extensions: 430053 Number of successful extensions: 1016 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 990 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1015 length of database: 80,573,946 effective HSP length: 47 effective length of database: 70,263,979 effective search space used: 1686335496 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)