Clone Name | rbasd27p06 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | IBBWP_MAIZE (P31862) Bowman-Birk type wound-induced proteinase i... | 50 | 6e-06 | 2 | PKSJ_BACSU (P40806) Putative polyketide synthase pksJ (PKS) | 30 | 3.6 | 3 | DTX3_HUMAN (Q8N9I9) Protein deltex-3 (Deltex-3) (Deltex3) | 30 | 6.1 | 4 | S230_PLAFO (P68875) Transmission-blocking target antigen S230 pr... | 30 | 6.1 | 5 | S230_PLAF7 (P68874) Transmission-blocking target antigen S230 pr... | 30 | 6.1 |
---|
>IBBWP_MAIZE (P31862) Bowman-Birk type wound-induced proteinase inhibitor WIP1| precursor Length = 102 Score = 49.7 bits (117), Expect = 6e-06 Identities = 40/102 (39%), Positives = 45/102 (44%), Gaps = 17/102 (16%) Frame = -2 Query: 488 STKLXAILILQTVLVMGI---LSHVNA-------DFFP---KCCXNCR-SFSGVDVCDDA 351 S L IL LQ LVMG+ L+ NA D P KCC NC SFSG+ CDD Sbjct: 4 SPHLVLILCLQAALVMGVFAALAKENAMVESKAIDINPGQLKCCTNCNFSFSGLYTCDDV 63 Query: 350 HPQCP---KGCSAXRVVTPSPHKTFRCADMKSTVDGTCGGPC 234 C K C + S + FRC D T G CG C Sbjct: 64 KKDCDPVCKKCVVAVHASYSGNNKFRCTD---TFLGMCGPKC 102
>PKSJ_BACSU (P40806) Putative polyketide synthase pksJ (PKS)| Length = 5045 Score = 30.4 bits (67), Expect = 3.6 Identities = 17/44 (38%), Positives = 22/44 (50%), Gaps = 2/44 (4%) Frame = +1 Query: 247 QVPSTVLFMSAQRNVL*GL--GVTTRXAEQPLGHWGWASSQTST 372 Q+P T +FMSA N L TT E P G+ W +Q+ T Sbjct: 1869 QIPQTSVFMSASNNSYRALLPSDTTESLETPDGYVSWVLAQSGT 1912
>DTX3_HUMAN (Q8N9I9) Protein deltex-3 (Deltex-3) (Deltex3)| Length = 347 Score = 29.6 bits (65), Expect = 6.1 Identities = 11/37 (29%), Positives = 20/37 (54%) Frame = -2 Query: 191 VPPRIKLR*DEQSSCCYVCVWAVLYGQQYVRCLSSLC 81 +PPR++ +EQ S C +C+ + + +C S C Sbjct: 149 LPPRLREEAEEQESTCPICLGEIQNAKTLEKCRHSFC 185
>S230_PLAFO (P68875) Transmission-blocking target antigen S230 precursor| Length = 3135 Score = 29.6 bits (65), Expect = 6.1 Identities = 15/33 (45%), Positives = 19/33 (57%) Frame = +3 Query: 363 DVDPREGPAVXAALGEEVGVNVGEDPHDQDGLE 461 DVD G V +GEEVG VGE+ ++ G E Sbjct: 376 DVDEEVGEEVGEEVGEEVGEEVGEEVGEEVGEE 408
>S230_PLAF7 (P68874) Transmission-blocking target antigen S230 precursor| Length = 3135 Score = 29.6 bits (65), Expect = 6.1 Identities = 15/33 (45%), Positives = 19/33 (57%) Frame = +3 Query: 363 DVDPREGPAVXAALGEEVGVNVGEDPHDQDGLE 461 DVD G V +GEEVG VGE+ ++ G E Sbjct: 376 DVDEEVGEEVGEEVGEEVGEEVGEEVGEEVGEE 408 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 61,978,548 Number of Sequences: 219361 Number of extensions: 1168055 Number of successful extensions: 3031 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 2916 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3013 length of database: 80,573,946 effective HSP length: 106 effective length of database: 57,321,680 effective search space used: 4585734400 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)