Clone Name | rbasd27p03 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | VSN1_NOCAE (P50186) NaeI very-short-patch-repair endonuclease (E... | 32 | 1.8 | 2 | MLL4_HUMAN (Q9UMN6) Myeloid/lymphoid or mixed-lineage leukemia p... | 31 | 4.0 | 3 | NXL1_LATSE (P01379) Long neurotoxin 1 precursor (Neurotoxin alph... | 31 | 4.0 |
---|
>VSN1_NOCAE (P50186) NaeI very-short-patch-repair endonuclease (EC 3.1.-.-)| (V.NaeI) Length = 166 Score = 32.0 bits (71), Expect = 1.8 Identities = 17/42 (40%), Positives = 23/42 (54%) Frame = -2 Query: 164 RKVLVYIFARNGYFWHTCWFHG*WVEGVNSVPEWWWNFKISR 39 RKV V+I +G FWH C HG + EW+W+ K+ R Sbjct: 80 RKVAVFI---DGCFWHVCPDHG----RQPTTNEWYWSPKLRR 114
>MLL4_HUMAN (Q9UMN6) Myeloid/lymphoid or mixed-lineage leukemia protein 4| (Trithorax homolog 2) Length = 2715 Score = 30.8 bits (68), Expect = 4.0 Identities = 20/55 (36%), Positives = 25/55 (45%) Frame = +3 Query: 30 PFKSTDFEVPPPLRHTIYTFNPSPMEPTGVPEIPISGKYVH*NLPIYTRRRGVDR 194 P K EV P LR I T P P EP VP P + +P+ +RR + R Sbjct: 551 PPKPPKVEVSPVLRPPITTSPPVPQEPAPVPSPPRAPTPPSTPVPLPEKRRSILR 605
>NXL1_LATSE (P01379) Long neurotoxin 1 precursor (Neurotoxin alpha) (Component| LSIII) Length = 87 Score = 30.8 bits (68), Expect = 4.0 Identities = 11/30 (36%), Positives = 13/30 (43%) Frame = +2 Query: 107 TNRCARNTHFWQICTLKPSYIYTKAWCGSW 196 T C N H Q C Y K+WC +W Sbjct: 21 TRECYLNPHDTQTCPSGQEICYVKSWCNAW 50 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 92,015,112 Number of Sequences: 219361 Number of extensions: 1821945 Number of successful extensions: 4336 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 4174 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4336 length of database: 80,573,946 effective HSP length: 108 effective length of database: 56,882,958 effective search space used: 6712189044 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)