Clone Name | rbasd27m23 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | M4K4_MOUSE (P97820) Mitogen-activated protein kinase kinase kina... | 31 | 2.4 | 2 | PCD19_MOUSE (Q80TF3) Protocadherin-19 precursor | 29 | 9.3 |
---|
>M4K4_MOUSE (P97820) Mitogen-activated protein kinase kinase kinase kinase 4| (EC 2.7.11.1) (MAPK/ERK kinase kinase kinase 4) (MEK kinase kinase 4) (MEKKK 4) (HPK/GCK-like kinase HGK) (Nck-interacting kinase) Length = 1233 Score = 31.2 bits (69), Expect = 2.4 Identities = 23/61 (37%), Positives = 29/61 (47%), Gaps = 12/61 (19%) Frame = -2 Query: 293 LLHVHRQREDAQRAGPPQYQ----------EPRPQDDRIH--REVKWILHRGYIASLLGN 150 LLH HR+ Q+ PPQ Q EP+P D REV+W ++ASL N Sbjct: 492 LLHDHRRPHAQQQPPPPQQQDRSKPSFHAPEPKPHYDPADRAREVQW----SHLASLKNN 547 Query: 149 V 147 V Sbjct: 548 V 548
>PCD19_MOUSE (Q80TF3) Protocadherin-19 precursor| Length = 1145 Score = 29.3 bits (64), Expect = 9.3 Identities = 17/59 (28%), Positives = 30/59 (50%) Frame = +3 Query: 33 TDKIN*LNREFITSLVFLHLCSHRKL*LGCHKLSHTSMDVPKQRSNISTV*NPFHFSMN 209 TDK+N ++ +TS + + L LGC + T ++V Q + +T + +H S N Sbjct: 796 TDKMNVVSCSSLTSSLNYFDYHQQTLPLGCRRSESTFLNVENQNTRNTTASHIYHHSFN 854 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 63,791,778 Number of Sequences: 219361 Number of extensions: 1062834 Number of successful extensions: 3451 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3253 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3450 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 5367617986 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)