Clone Name | rbasd27l23 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | PHK_MYCPA (Q73ZM8) Probable phosphoketolase (EC 4.1.2.-) | 30 | 1.2 | 2 | THT1_SCHPO (Q09684) Nuclear fusion protein tht1 | 29 | 2.6 | 3 | NELL2_MOUSE (Q61220) Protein kinase C-binding protein NELL2 prec... | 28 | 7.5 |
---|
>PHK_MYCPA (Q73ZM8) Probable phosphoketolase (EC 4.1.2.-)| Length = 804 Score = 30.4 bits (67), Expect = 1.2 Identities = 15/37 (40%), Positives = 21/37 (56%), Gaps = 1/37 (2%) Frame = -3 Query: 271 AHIMYCT-GLGLGTWXATAEAAQMRTRVVVACYTSVP 164 A I +CT GLG+ W +TA + VV+AC +P Sbjct: 602 AAIAHCTRGLGIWDWASTARSIGAEPDVVLACAGDIP 638
>THT1_SCHPO (Q09684) Nuclear fusion protein tht1| Length = 577 Score = 29.3 bits (64), Expect = 2.6 Identities = 12/35 (34%), Positives = 19/35 (54%) Frame = +2 Query: 116 RGSVCICFPSIENHTYWYTSIASHYYSRTHLSCLS 220 RGS C +E+ + W+ S SH++ HL L+ Sbjct: 114 RGSQSECVSKLESTSTWWLSFTSHFHDVNHLCRLA 148
>NELL2_MOUSE (Q61220) Protein kinase C-binding protein NELL2 precursor (NEL-like| protein 2) (MEL91 protein) Length = 816 Score = 27.7 bits (60), Expect = 7.5 Identities = 13/31 (41%), Positives = 19/31 (61%), Gaps = 2/31 (6%) Frame = -1 Query: 279 VRMRTLCIVQGLG--WELGMRPLRQLRCVRE 193 V +RT C++ GLG W LG+ P Q+ + E Sbjct: 5 VLLRTFCVILGLGAVWGLGVDPSLQIDVLTE 35 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 42,240,960 Number of Sequences: 219361 Number of extensions: 755301 Number of successful extensions: 1527 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1506 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1527 length of database: 80,573,946 effective HSP length: 83 effective length of database: 62,366,983 effective search space used: 1496807592 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)