Clone Name | rbasd27l09 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | GLHA_ANGAN (P27794) Glycoprotein hormones alpha chain precursor ... | 33 | 0.73 | 2 | GH311_ORYSA (P0C0M3) Probable indole-3-acetic acid-amido synthet... | 30 | 8.1 |
---|
>GLHA_ANGAN (P27794) Glycoprotein hormones alpha chain precursor (Gonadotropin| alpha chain) (GTH-alpha) Length = 117 Score = 33.5 bits (75), Expect = 0.73 Identities = 13/28 (46%), Positives = 19/28 (67%) Frame = -2 Query: 335 HFLLSFGSQEMSRGGCEECYCQMMMVFS 252 H + S+ + EM+RGGC+EC Q +FS Sbjct: 20 HIIDSYPNNEMARGGCDECRLQENKIFS 47
>GH311_ORYSA (P0C0M3) Probable indole-3-acetic acid-amido synthetase GH3.11 (EC| 6.3.2.-) (Auxin-responsive GH3-like protein 11) (OsGH3-11) Length = 591 Score = 30.0 bits (66), Expect = 8.1 Identities = 20/82 (24%), Positives = 37/82 (45%), Gaps = 6/82 (7%) Frame = +1 Query: 148 NYKDIYRTTTTASH*IMRATFIPCA-SGWPLIYRVQEKTIIIWQ*HSSHPPRDISCDPKL 324 N +D++ + TTA + ++ + + I V ++ W+ S+H R D +L Sbjct: 443 NEEDLHNSVTTAKKILENQNYLLLEYTSYTDISTVPGHYVLFWEIKSTHDERPAPLDAQL 502 Query: 325 NRKCCAYLQIMILY-----RAH 375 CCA ++ + Y RAH Sbjct: 503 LESCCAAVEESLDYVYRRCRAH 524 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 103,048,909 Number of Sequences: 219361 Number of extensions: 2043282 Number of successful extensions: 5542 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 5334 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5538 length of database: 80,573,946 effective HSP length: 110 effective length of database: 56,444,236 effective search space used: 7958637276 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)