Clone Name | rbasd27f11 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | PUR9_RHOBA (Q7UKJ8) Bifunctional purine biosynthesis protein pur... | 30 | 9.1 | 2 | GET1_HUMAN (O95210) Genethonin-1 (GENX-3414) | 30 | 9.1 |
---|
>PUR9_RHOBA (Q7UKJ8) Bifunctional purine biosynthesis protein purH [Includes:| Phosphoribosylaminoimidazolecarboxamide formyltransferase (EC 2.1.2.3) (AICAR transformylase); IMP cyclohydrolase (EC 3.5.4.10) (Inosinicase) (IMP synthetase) (ATIC)] Length = 523 Score = 29.6 bits (65), Expect = 9.1 Identities = 18/61 (29%), Positives = 26/61 (42%), Gaps = 8/61 (13%) Frame = -1 Query: 236 PFYWDKVLANPNQSMAWHDIKFG---SFHVNEDMI-----EALFGYGAGNRNKTKDKELA 81 P W+ V P W DI FG HV + I +L G GAG ++ E++ Sbjct: 395 PLQWNTVTETPVDDDLWDDISFGWEMVRHVKSNAIVLAKDTSLIGVGAGQMSRVDSVEIS 454 Query: 80 M 78 + Sbjct: 455 I 455
>GET1_HUMAN (O95210) Genethonin-1 (GENX-3414)| Length = 358 Score = 29.6 bits (65), Expect = 9.1 Identities = 18/55 (32%), Positives = 28/55 (50%), Gaps = 1/55 (1%) Frame = -1 Query: 671 PLLHMQLANTXGSSPIIHASSSQLHKDDQRVRTSKAGA-SMSRCFPCCFKTSTDV 510 P+L++ G S ++ A Q+H +RV AG+ +S F + TSTDV Sbjct: 224 PVLNLNQGMDNGRSTLVEARGQQVHGKMERVAVMPAGSQQVSVRFQVHYVTSTDV 278 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 87,198,668 Number of Sequences: 219361 Number of extensions: 1597004 Number of successful extensions: 3386 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3309 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3386 length of database: 80,573,946 effective HSP length: 109 effective length of database: 56,663,597 effective search space used: 6912958834 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)