Clone Name | rbasd27e05 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | CAR14_MOUSE (Q99KF0) Caspase recruitment domain-containing prote... | 31 | 3.6 | 2 | Y2917_ACIAD (Q6F8I3) UPF0176 protein ACIAD2917 | 30 | 8.0 |
---|
>CAR14_MOUSE (Q99KF0) Caspase recruitment domain-containing protein 14| (Bcl10-interacting MAGUK protein 2) (Bimp2) Length = 999 Score = 31.2 bits (69), Expect = 3.6 Identities = 18/49 (36%), Positives = 23/49 (46%) Frame = +1 Query: 40 ITPILFLPRKAWFSGFSNALRMETKEYNTV*CVAATPNYGQAQQQRLHL 186 +T +F R W + N M+ E T+ PNY QAQQQ L L Sbjct: 702 VTDTMFQGRSCWHAHHVNPYTMKDMEPGTI------PNYSQAQQQLLAL 744
>Y2917_ACIAD (Q6F8I3) UPF0176 protein ACIAD2917| Length = 314 Score = 30.0 bits (66), Expect = 8.0 Identities = 16/37 (43%), Positives = 18/37 (48%) Frame = +1 Query: 211 QNQKCSDASV*VTQDECPTSRRSHGDECAYCILEKTT 321 QN KC +T +E HG C YCI EKTT Sbjct: 257 QNVKCHACGWPLTPEEVALPSYEHGVSCVYCI-EKTT 292 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 65,962,659 Number of Sequences: 219361 Number of extensions: 1128114 Number of successful extensions: 2261 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2223 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2253 length of database: 80,573,946 effective HSP length: 109 effective length of database: 56,663,597 effective search space used: 7932903580 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)