Clone Name | rbasd26o16 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | STS_HUMAN (P08842) Steryl-sulfatase precursor (EC 3.1.6.2) (Ster... | 32 | 1.6 | 2 | EXP14_ARATH (Q9FMA0) Putative alpha-expansin 14 precursor (AtEXP... | 31 | 3.6 | 3 | STS_RAT (P15589) Steryl-sulfatase precursor (EC 3.1.6.2) (Steroi... | 30 | 6.1 |
---|
>STS_HUMAN (P08842) Steryl-sulfatase precursor (EC 3.1.6.2) (Steroid| sulfatase) (Steryl-sulfate sulfohydrolase) (Arylsulfatase C) (ASC) Length = 583 Score = 32.0 bits (71), Expect = 1.6 Identities = 10/31 (32%), Positives = 17/31 (54%) Frame = +1 Query: 55 QKNEHDRCLFSSMVYTNTLAWHPSNNSGTWK 147 Q+++H+ Y N + WHP N++ WK Sbjct: 435 QRSDHEFLFHYCNAYLNAVRWHPQNSTSIWK 465
>EXP14_ARATH (Q9FMA0) Putative alpha-expansin 14 precursor (AtEXPA14) (At-EXP14)| (AtEx14) (Ath-ExpAlpha-1.5) Length = 255 Score = 30.8 bits (68), Expect = 3.6 Identities = 22/80 (27%), Positives = 36/80 (45%), Gaps = 5/80 (6%) Frame = +1 Query: 10 VFHVSEGCQQCCTLRQKNEHDRCLFSSMVYTNTLAWHPS----NNSGTWKICK*-QHHIY 174 +F+ + C C ++ ++ C+ ++ T T P+ NN+G W C QHH Sbjct: 71 LFNGGQSCGACFQIKCVDDPKWCIGGTITVTGTNFCPPNFAQANNAGGW--CNPPQHHFD 128 Query: 175 IQVDMHAPSLQLKQGVPPVQ 234 + + Q K GV PVQ Sbjct: 129 LAQPIFLRIAQYKAGVVPVQ 148
>STS_RAT (P15589) Steryl-sulfatase precursor (EC 3.1.6.2) (Steroid| sulfatase) (Steryl-sulfate sulfohydrolase) (Arylsulfatase C) (ASC) Length = 577 Score = 30.0 bits (66), Expect = 6.1 Identities = 11/31 (35%), Positives = 16/31 (51%) Frame = +1 Query: 55 QKNEHDRCLFSSMVYTNTLAWHPSNNSGTWK 147 Q +EH+ Y + +AW P N+S WK Sbjct: 434 QHSEHEFLFHYCNAYLSAVAWRPHNSSSVWK 464 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 91,539,361 Number of Sequences: 219361 Number of extensions: 1955435 Number of successful extensions: 5373 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 5146 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5373 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 5995743495 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)