Clone Name | rbasd26o12 |
---|---|
Clone Library Name | barley_pub |
>RBS3_WHEAT (P07398) Ribulose bisphosphate carboxylase small chain clone 512| (EC 4.1.1.39) (RuBisCO small subunit) (Fragment) Length = 113 Score = 95.1 bits (235), Expect = 4e-20 Identities = 45/49 (91%), Positives = 46/49 (93%) Frame = -3 Query: 289 TQVLNEVEEVKKEYPXAYVRIIGFXNMRQVQCVSFIAFKPPXCEESGKA 143 TQV+NEVEEVKKEYP AYVRIIGF NMRQVQCVSFIAFKPP CEESGKA Sbjct: 65 TQVINEVEEVKKEYPDAYVRIIGFDNMRQVQCVSFIAFKPPGCEESGKA 113
>RBS_HORVU (Q40004) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 174 Score = 94.7 bits (234), Expect = 5e-20 Identities = 45/49 (91%), Positives = 46/49 (93%) Frame = -3 Query: 289 TQVLNEVEEVKKEYPXAYVRIIGFXNMRQVQCVSFIAFKPPXCEESGKA 143 TQVLNEVEEVKKEYP AYVRIIGF NMRQVQCVSFIAFKPP C+ESGKA Sbjct: 126 TQVLNEVEEVKKEYPDAYVRIIGFDNMRQVQCVSFIAFKPPGCQESGKA 174
>RBS2_WHEAT (P26667) Ribulose bisphosphate carboxylase small chain PW9,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit PW9) Length = 175 Score = 94.4 bits (233), Expect = 7e-20 Identities = 44/49 (89%), Positives = 46/49 (93%) Frame = -3 Query: 289 TQVLNEVEEVKKEYPXAYVRIIGFXNMRQVQCVSFIAFKPPXCEESGKA 143 TQVLNEVEEVKKEYP AYVR+IGF NMRQVQCVSFIAF+PP CEESGKA Sbjct: 127 TQVLNEVEEVKKEYPDAYVRVIGFDNMRQVQCVSFIAFRPPGCEESGKA 175
>RBS1_WHEAT (P00871) Ribulose bisphosphate carboxylase small chain PWS4.3,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit PWS4.3) Length = 174 Score = 93.2 bits (230), Expect = 2e-19 Identities = 43/49 (87%), Positives = 46/49 (93%) Frame = -3 Query: 289 TQVLNEVEEVKKEYPXAYVRIIGFXNMRQVQCVSFIAFKPPXCEESGKA 143 TQVLNEVEEVKKEYP AYVR+IGF N+RQVQCVSFIAF+PP CEESGKA Sbjct: 126 TQVLNEVEEVKKEYPDAYVRVIGFDNLRQVQCVSFIAFRPPGCEESGKA 174
>RBS_AEGTA (Q38793) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 175 Score = 80.1 bits (196), Expect = 1e-15 Identities = 39/49 (79%), Positives = 41/49 (83%) Frame = -3 Query: 289 TQVLNEVEEVKKEYPXAYVRIIGFXNMRQVQCVSFIAFKPPXCEESGKA 143 TQV+ EVEEV+KEYP Y RIIGF NMRQVQ VSFIA KPP CEESGKA Sbjct: 127 TQVIPEVEEVRKEYPDPYCRIIGFDNMRQVQSVSFIASKPPGCEESGKA 175
>RBS3_ORYSA (P18567) Ribulose bisphosphate carboxylase small chain C,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit C) Length = 175 Score = 76.6 bits (187), Expect = 1e-14 Identities = 35/47 (74%), Positives = 40/47 (85%) Frame = -3 Query: 289 TQVLNEVEEVKKEYPXAYVRIIGFXNMRQVQCVSFIAFKPPXCEESG 149 TQVL E+EE KK YP A+VRIIGF N+RQVQ +SFIA+KPP CEESG Sbjct: 127 TQVLKELEEAKKAYPDAFVRIIGFDNVRQVQLISFIAYKPPGCEESG 173
>RBS2_ORYSA (P18566) Ribulose bisphosphate carboxylase small chain A,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit A) Length = 175 Score = 76.3 bits (186), Expect = 2e-14 Identities = 34/47 (72%), Positives = 40/47 (85%) Frame = -3 Query: 289 TQVLNEVEEVKKEYPXAYVRIIGFXNMRQVQCVSFIAFKPPXCEESG 149 TQVL E+EE KK YP A++RIIGF N+RQVQ +SFIA+KPP CEESG Sbjct: 127 TQVLKELEEAKKAYPDAFIRIIGFDNVRQVQLISFIAYKPPGCEESG 173
>RBS3_AMAHP (Q9XGX4) Ribulose bisphosphate carboxylase small chain 3,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 3) Length = 180 Score = 72.0 bits (175), Expect = 4e-13 Identities = 33/40 (82%), Positives = 35/40 (87%) Frame = -3 Query: 286 QVLNEVEEVKKEYPXAYVRIIGFXNMRQVQCVSFIAFKPP 167 QVLNEVEE KK YP A++RIIGF N RQVQCVSFIAFKPP Sbjct: 139 QVLNEVEEAKKAYPSAFIRIIGFDNKRQVQCVSFIAFKPP 178
>RBS3B_ARATH (P10798) Ribulose bisphosphate carboxylase small chain 3B,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 3B) Length = 181 Score = 70.9 bits (172), Expect = 8e-13 Identities = 32/45 (71%), Positives = 37/45 (82%) Frame = -3 Query: 286 QVLNEVEEVKKEYPXAYVRIIGFXNMRQVQCVSFIAFKPPXCEES 152 QVL EVEE KKEYP A++RIIGF N RQVQC+SFIA+KPP E+ Sbjct: 137 QVLKEVEECKKEYPGAFIRIIGFDNTRQVQCISFIAYKPPSFTEA 181
>RBS2B_ARATH (P10797) Ribulose bisphosphate carboxylase small chain 2B,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 2B) Length = 181 Score = 70.9 bits (172), Expect = 8e-13 Identities = 32/45 (71%), Positives = 37/45 (82%) Frame = -3 Query: 286 QVLNEVEEVKKEYPXAYVRIIGFXNMRQVQCVSFIAFKPPXCEES 152 QVL EVEE KKEYP A++RIIGF N RQVQC+SFIA+KPP E+ Sbjct: 137 QVLKEVEECKKEYPGAFIRIIGFDNTRQVQCISFIAYKPPSFTEA 181
>RBS1A_ARATH (P10795) Ribulose bisphosphate carboxylase small chain 1A,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 1A) Length = 180 Score = 69.7 bits (169), Expect = 2e-12 Identities = 31/40 (77%), Positives = 35/40 (87%) Frame = -3 Query: 286 QVLNEVEEVKKEYPXAYVRIIGFXNMRQVQCVSFIAFKPP 167 QVL EVEE KKEYP A++RIIGF N RQVQC+SFIA+KPP Sbjct: 137 QVLKEVEECKKEYPNAFIRIIGFDNTRQVQCISFIAYKPP 176
>RBS1B_ARATH (P10796) Ribulose bisphosphate carboxylase small chain 1B,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 1B) Length = 181 Score = 69.7 bits (169), Expect = 2e-12 Identities = 31/40 (77%), Positives = 35/40 (87%) Frame = -3 Query: 286 QVLNEVEEVKKEYPXAYVRIIGFXNMRQVQCVSFIAFKPP 167 QVL EVEE KKEYP A++RIIGF N RQVQC+SFIA+KPP Sbjct: 137 QVLKEVEECKKEYPGAFIRIIGFDNTRQVQCISFIAYKPP 176
>RBS_CAPAN (O65349) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 187 Score = 68.6 bits (166), Expect = 4e-12 Identities = 30/40 (75%), Positives = 36/40 (90%) Frame = -3 Query: 289 TQVLNEVEEVKKEYPXAYVRIIGFXNMRQVQCVSFIAFKP 170 TQVLNEV+E KK YP A++RIIGF N+RQVQC+SFIA+KP Sbjct: 138 TQVLNEVQEAKKAYPQAWIRIIGFDNVRQVQCISFIAYKP 177
>RBS_SINAL (P13951) Ribulose bisphosphate carboxylase small chain (EC| 4.1.1.39) (RuBisCO small subunit) (Fragment) Length = 82 Score = 68.2 bits (165), Expect = 5e-12 Identities = 30/40 (75%), Positives = 35/40 (87%) Frame = -3 Query: 286 QVLNEVEEVKKEYPXAYVRIIGFXNMRQVQCVSFIAFKPP 167 QVL EV+E KKEYP A++RIIGF N RQVQC+SFIA+KPP Sbjct: 38 QVLKEVQECKKEYPNAFIRIIGFDNNRQVQCISFIAYKPP 77
>RBS1_AMAHP (Q42516) Ribulose bisphosphate carboxylase small chain 1,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 1) Length = 183 Score = 68.2 bits (165), Expect = 5e-12 Identities = 31/39 (79%), Positives = 34/39 (87%) Frame = -3 Query: 286 QVLNEVEEVKKEYPXAYVRIIGFXNMRQVQCVSFIAFKP 170 QVLNEVEE KK YP A++RIIGF N RQVQCVSFIA+KP Sbjct: 141 QVLNEVEEAKKAYPSAFIRIIGFDNKRQVQCVSFIAYKP 179
>RBS2_AMAHP (Q9XGX5) Ribulose bisphosphate carboxylase small chain 2,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 2) Length = 184 Score = 68.2 bits (165), Expect = 5e-12 Identities = 31/39 (79%), Positives = 34/39 (87%) Frame = -3 Query: 286 QVLNEVEEVKKEYPXAYVRIIGFXNMRQVQCVSFIAFKP 170 QVLNEVEE KK YP A++RIIGF N RQVQCVSFIA+KP Sbjct: 142 QVLNEVEEAKKAYPTAFIRIIGFDNKRQVQCVSFIAYKP 180
>RBS2_PETHY (P04715) Ribulose bisphosphate carboxylase small chain SSU11A,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit SSU11A) Length = 180 Score = 67.8 bits (164), Expect = 7e-12 Identities = 29/41 (70%), Positives = 36/41 (87%) Frame = -3 Query: 289 TQVLNEVEEVKKEYPXAYVRIIGFXNMRQVQCVSFIAFKPP 167 TQVL E++E KK YP A++RIIGF N+RQVQC+SFIA+KPP Sbjct: 138 TQVLGELQEAKKAYPNAWIRIIGFDNVRQVQCISFIAYKPP 178
>RBS1_PETHY (P04714) Ribulose bisphosphate carboxylase small chain SSU8,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit SSU8) Length = 180 Score = 67.8 bits (164), Expect = 7e-12 Identities = 29/41 (70%), Positives = 36/41 (87%) Frame = -3 Query: 289 TQVLNEVEEVKKEYPXAYVRIIGFXNMRQVQCVSFIAFKPP 167 TQVL E++E KK YP A++RIIGF N+RQVQC+SFIA+KPP Sbjct: 138 TQVLGELQEAKKAYPNAWIRIIGFDNVRQVQCISFIAYKPP 178
>RBS8_NICPL (P26573) Ribulose bisphosphate carboxylase small chain 8B,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 8B) Length = 180 Score = 67.0 bits (162), Expect = 1e-11 Identities = 31/40 (77%), Positives = 35/40 (87%) Frame = -3 Query: 289 TQVLNEVEEVKKEYPXAYVRIIGFXNMRQVQCVSFIAFKP 170 TQVL EVEE KK YP A+VRIIGF N+RQVQC+SFIA+KP Sbjct: 138 TQVLAEVEEAKKAYPQAWVRIIGFDNVRQVQCISFIAYKP 177
>RBS_CUCSA (P08474) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 189 Score = 67.0 bits (162), Expect = 1e-11 Identities = 27/40 (67%), Positives = 36/40 (90%) Frame = -3 Query: 289 TQVLNEVEEVKKEYPXAYVRIIGFXNMRQVQCVSFIAFKP 170 +QV+ E+EE KKEYP A++R+IGF N+RQVQC+SFIA+KP Sbjct: 140 SQVIQEIEEAKKEYPDAFIRVIGFDNVRQVQCISFIAYKP 179
>RBS_RAPSA (P08135) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 181 Score = 66.6 bits (161), Expect = 2e-11 Identities = 30/40 (75%), Positives = 34/40 (85%) Frame = -3 Query: 286 QVLNEVEEVKKEYPXAYVRIIGFXNMRQVQCVSFIAFKPP 167 QVL EV+E KKEYP A +RIIGF N RQVQC+SFIA+KPP Sbjct: 137 QVLKEVQECKKEYPNALIRIIGFDNNRQVQCISFIAYKPP 176
>RBS2_NICSY (P22433) Ribulose bisphosphate carboxylase small chain S41,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit S41) Length = 181 Score = 66.6 bits (161), Expect = 2e-11 Identities = 30/40 (75%), Positives = 35/40 (87%) Frame = -3 Query: 289 TQVLNEVEEVKKEYPXAYVRIIGFXNMRQVQCVSFIAFKP 170 TQVL EVEE KK YP A++RIIGF N+RQVQC+SFIA+KP Sbjct: 139 TQVLAEVEEAKKAYPQAWIRIIGFDNVRQVQCISFIAYKP 178
>RBS_TOBAC (P69249) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) (TSSU3-8) Length = 180 Score = 66.6 bits (161), Expect = 2e-11 Identities = 30/40 (75%), Positives = 35/40 (87%) Frame = -3 Query: 289 TQVLNEVEEVKKEYPXAYVRIIGFXNMRQVQCVSFIAFKP 170 TQVL EVEE KK YP A++RIIGF N+RQVQC+SFIA+KP Sbjct: 138 TQVLAEVEEAKKAYPQAWIRIIGFDNVRQVQCISFIAYKP 177
>RBSC_SOLTU (P26577) Ribulose bisphosphate carboxylase small chain 2C,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 2C) Length = 180 Score = 66.6 bits (161), Expect = 2e-11 Identities = 30/40 (75%), Positives = 35/40 (87%) Frame = -3 Query: 289 TQVLNEVEEVKKEYPXAYVRIIGFXNMRQVQCVSFIAFKP 170 TQVL EVEE KK YP A++RIIGF N+RQVQC+SFIA+KP Sbjct: 138 TQVLAEVEEAKKAYPQAWIRIIGFDNVRQVQCISFIAYKP 177
>RBSB_SOLTU (P26576) Ribulose bisphosphate carboxylase small chain 2B,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 2B) Length = 180 Score = 66.6 bits (161), Expect = 2e-11 Identities = 30/40 (75%), Positives = 35/40 (87%) Frame = -3 Query: 289 TQVLNEVEEVKKEYPXAYVRIIGFXNMRQVQCVSFIAFKP 170 TQVL EVEE KK YP A++RIIGF N+RQVQC+SFIA+KP Sbjct: 138 TQVLAEVEEAKKAYPQAWIRIIGFDNVRQVQCISFIAYKP 177
>RBSA_SOLTU (P26575) Ribulose bisphosphate carboxylase small chain 2A,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 2A) Length = 180 Score = 66.6 bits (161), Expect = 2e-11 Identities = 30/40 (75%), Positives = 35/40 (87%) Frame = -3 Query: 289 TQVLNEVEEVKKEYPXAYVRIIGFXNMRQVQCVSFIAFKP 170 TQVL EVEE KK YP A++RIIGF N+RQVQC+SFIA+KP Sbjct: 138 TQVLAEVEEAKKAYPQAWIRIIGFDNVRQVQCISFIAYKP 177
>RBS1_NICSY (P69250) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 180 Score = 66.6 bits (161), Expect = 2e-11 Identities = 30/40 (75%), Positives = 35/40 (87%) Frame = -3 Query: 289 TQVLNEVEEVKKEYPXAYVRIIGFXNMRQVQCVSFIAFKP 170 TQVL EVEE KK YP A++RIIGF N+RQVQC+SFIA+KP Sbjct: 138 TQVLAEVEEAKKAYPQAWIRIIGFDNVRQVQCISFIAYKP 177
>RBS2_SPIOL (Q43832) Ribulose bisphosphate carboxylase small chain 2,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 2) Length = 180 Score = 66.2 bits (160), Expect = 2e-11 Identities = 30/39 (76%), Positives = 35/39 (89%) Frame = -3 Query: 286 QVLNEVEEVKKEYPXAYVRIIGFXNMRQVQCVSFIAFKP 170 QVLNE+EE KKEYP A++RIIGF + RQVQCVSFIA+KP Sbjct: 139 QVLNELEECKKEYPNAFIRIIGFDSNRQVQCVSFIAYKP 177
>RBS1_ORYSA (P05347) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 172 Score = 66.2 bits (160), Expect = 2e-11 Identities = 32/47 (68%), Positives = 38/47 (80%) Frame = -3 Query: 289 TQVLNEVEEVKKEYPXAYVRIIGFXNMRQVQCVSFIAFKPPXCEESG 149 TQV+ E+EE KK YP A+VRIIGF N+RQVQ +SFIA+ P CEESG Sbjct: 125 TQVVKELEEAKKAYPDAFVRIIGFDNVRQVQLISFIAYN-PGCEESG 170
>RBS3B_LYCES (P05349) Ribulose bisphosphate carboxylase small chain 3B,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 3B) Length = 180 Score = 65.9 bits (159), Expect = 3e-11 Identities = 30/40 (75%), Positives = 35/40 (87%) Frame = -3 Query: 289 TQVLNEVEEVKKEYPXAYVRIIGFXNMRQVQCVSFIAFKP 170 TQVL EV+E KK YP A+VRIIGF N+RQVQC+SFIA+KP Sbjct: 138 TQVLAEVQEAKKAYPQAWVRIIGFDNVRQVQCISFIAYKP 177
>RBS3A_LYCES (P07180) Ribulose bisphosphate carboxylase small chain 3A/3C,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 3A/3C) Length = 180 Score = 65.9 bits (159), Expect = 3e-11 Identities = 30/40 (75%), Positives = 35/40 (87%) Frame = -3 Query: 289 TQVLNEVEEVKKEYPXAYVRIIGFXNMRQVQCVSFIAFKP 170 TQVL EV+E KK YP A+VRIIGF N+RQVQC+SFIA+KP Sbjct: 138 TQVLAEVQEAKKAYPQAWVRIIGFDNVRQVQCISFIAYKP 177
>RBS2A_LYCES (P07179) Ribulose bisphosphate carboxylase small chain 2A,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 2A) (LESS 5) Length = 180 Score = 65.9 bits (159), Expect = 3e-11 Identities = 30/40 (75%), Positives = 35/40 (87%) Frame = -3 Query: 289 TQVLNEVEEVKKEYPXAYVRIIGFXNMRQVQCVSFIAFKP 170 TQVL EV+E KK YP A+VRIIGF N+RQVQC+SFIA+KP Sbjct: 138 TQVLAEVQEAKKAYPQAWVRIIGFDNVRQVQCISFIAYKP 177
>RBS2_BRANA (P27985) Ribulose bisphosphate carboxylase small chain F1,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit F1) Length = 181 Score = 65.9 bits (159), Expect = 3e-11 Identities = 29/40 (72%), Positives = 34/40 (85%) Frame = -3 Query: 286 QVLNEVEEVKKEYPXAYVRIIGFXNMRQVQCVSFIAFKPP 167 QVL EV+E K EYP A++RIIGF N RQVQC+SFIA+KPP Sbjct: 137 QVLKEVQECKTEYPNAFIRIIGFDNNRQVQCISFIAYKPP 176
>RBS1_LYCES (P08706) Ribulose bisphosphate carboxylase small chain 1,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 1) (LESS17) Length = 181 Score = 65.9 bits (159), Expect = 3e-11 Identities = 30/40 (75%), Positives = 35/40 (87%) Frame = -3 Query: 289 TQVLNEVEEVKKEYPXAYVRIIGFXNMRQVQCVSFIAFKP 170 TQVL EV+E KK YP A+VRIIGF N+RQVQC+SFIA+KP Sbjct: 139 TQVLAEVQEAKKAYPQAWVRIIGFDNVRQVQCISFIAYKP 178
>RBS1_BRANA (P05346) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 181 Score = 65.9 bits (159), Expect = 3e-11 Identities = 29/40 (72%), Positives = 34/40 (85%) Frame = -3 Query: 286 QVLNEVEEVKKEYPXAYVRIIGFXNMRQVQCVSFIAFKPP 167 QVL EV+E K EYP A++RIIGF N RQVQC+SFIA+KPP Sbjct: 137 QVLKEVQECKTEYPNAFIRIIGFDNNRQVQCISFIAYKPP 176
>RBS3_SOLTU (P32764) Ribulose bisphosphate carboxylase small chain 3,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 3) Length = 181 Score = 65.5 bits (158), Expect = 3e-11 Identities = 29/40 (72%), Positives = 35/40 (87%) Frame = -3 Query: 289 TQVLNEVEEVKKEYPXAYVRIIGFXNMRQVQCVSFIAFKP 170 TQVL EV+E KK YP A++RIIGF N+RQVQC+SFIA+KP Sbjct: 139 TQVLAEVQEAKKAYPQAWIRIIGFDNVRQVQCISFIAYKP 178
>RBS1_SOLTU (P26574) Ribulose bisphosphate carboxylase small chain 1,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 1) Length = 181 Score = 65.5 bits (158), Expect = 3e-11 Identities = 29/40 (72%), Positives = 35/40 (87%) Frame = -3 Query: 289 TQVLNEVEEVKKEYPXAYVRIIGFXNMRQVQCVSFIAFKP 170 TQVL EV+E KK YP A++RIIGF N+RQVQC+SFIA+KP Sbjct: 139 TQVLAEVQECKKSYPQAWIRIIGFDNVRQVQCISFIAYKP 178
>RBS_MUSAC (O24045) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 180 Score = 64.7 bits (156), Expect = 6e-11 Identities = 29/39 (74%), Positives = 33/39 (84%) Frame = -3 Query: 286 QVLNEVEEVKKEYPXAYVRIIGFXNMRQVQCVSFIAFKP 170 QV EVEE KKEYP A++RIIGF N RQVQC+SFIA+KP Sbjct: 139 QVAKEVEECKKEYPHAFIRIIGFDNNRQVQCISFIAYKP 177
>RBS_GOSHI (P31333) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 182 Score = 64.7 bits (156), Expect = 6e-11 Identities = 28/39 (71%), Positives = 34/39 (87%) Frame = -3 Query: 286 QVLNEVEEVKKEYPXAYVRIIGFXNMRQVQCVSFIAFKP 170 QVL E+E KKEYP A++RIIGF N+RQVQC+SFIA+KP Sbjct: 141 QVLEELENCKKEYPNAFIRIIGFDNVRQVQCISFIAYKP 179
>RBS_GLYTA (Q42823) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 178 Score = 64.3 bits (155), Expect = 8e-11 Identities = 27/41 (65%), Positives = 35/41 (85%) Frame = -3 Query: 289 TQVLNEVEEVKKEYPXAYVRIIGFXNMRQVQCVSFIAFKPP 167 +QVL E++E K YP A++RIIGF N+RQVQC+SFIA+KPP Sbjct: 136 SQVLKELQEAKTAYPNAFIRIIGFDNVRQVQCISFIAYKPP 176
>RBS_PYRPY (P24007) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 183 Score = 63.9 bits (154), Expect = 1e-10 Identities = 27/40 (67%), Positives = 35/40 (87%) Frame = -3 Query: 289 TQVLNEVEEVKKEYPXAYVRIIGFXNMRQVQCVSFIAFKP 170 +QVL E+EE KK YP +++RIIGF N+RQVQC+SFIA+KP Sbjct: 141 SQVLKELEEAKKAYPQSFIRIIGFDNVRQVQCISFIAYKP 180
>RBS_MALSP (Q02980) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 183 Score = 63.9 bits (154), Expect = 1e-10 Identities = 27/40 (67%), Positives = 35/40 (87%) Frame = -3 Query: 289 TQVLNEVEEVKKEYPXAYVRIIGFXNMRQVQCVSFIAFKP 170 +QVL E+EE KK YP +++RIIGF N+RQVQC+SFIA+KP Sbjct: 141 SQVLKELEEAKKAYPQSFIRIIGFDNVRQVQCISFIAYKP 180
>RBS_STELP (Q41351) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 180 Score = 63.5 bits (153), Expect = 1e-10 Identities = 28/40 (70%), Positives = 34/40 (85%) Frame = -3 Query: 289 TQVLNEVEEVKKEYPXAYVRIIGFXNMRQVQCVSFIAFKP 170 TQV EV+E KK YP A++RIIGF N+RQVQC+SFIA+KP Sbjct: 138 TQVAAEVQEAKKAYPDAHIRIIGFDNVRQVQCISFIAYKP 177
>RBS4_MESCR (Q08184) Ribulose bisphosphate carboxylase small chain 4,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 4) Length = 183 Score = 63.5 bits (153), Expect = 1e-10 Identities = 28/40 (70%), Positives = 35/40 (87%) Frame = -3 Query: 289 TQVLNEVEEVKKEYPXAYVRIIGFXNMRQVQCVSFIAFKP 170 +QV+ E+EE KK YP A++RIIGF N+RQVQCVSFIA+KP Sbjct: 139 SQVVAELEEAKKAYPEAFIRIIGFDNVRQVQCVSFIAYKP 178
>RBS_FAGCR (O22077) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 182 Score = 63.5 bits (153), Expect = 1e-10 Identities = 27/41 (65%), Positives = 34/41 (82%) Frame = -3 Query: 289 TQVLNEVEEVKKEYPXAYVRIIGFXNMRQVQCVSFIAFKPP 167 TQVL E++E K YP +++RIIGF N RQVQC+SFIA+KPP Sbjct: 140 TQVLAELQEASKTYPTSHIRIIGFDNKRQVQCISFIAYKPP 180
>RBS5_MESCR (Q08185) Ribulose bisphosphate carboxylase small chain 5,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 5) Length = 182 Score = 63.5 bits (153), Expect = 1e-10 Identities = 28/40 (70%), Positives = 35/40 (87%) Frame = -3 Query: 289 TQVLNEVEEVKKEYPXAYVRIIGFXNMRQVQCVSFIAFKP 170 +QV+ E+EE KK YP A++RIIGF N+RQVQCVSFIA+KP Sbjct: 138 SQVVAELEEAKKAYPEAFIRIIGFDNVRQVQCVSFIAYKP 177
>RBS6_MESCR (Q08186) Ribulose bisphosphate carboxylase small chain 6,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 6) Length = 186 Score = 63.5 bits (153), Expect = 1e-10 Identities = 28/40 (70%), Positives = 35/40 (87%) Frame = -3 Query: 289 TQVLNEVEEVKKEYPXAYVRIIGFXNMRQVQCVSFIAFKP 170 +QV+ E+EE KK YP A++RIIGF N+RQVQCVSFIA+KP Sbjct: 142 SQVVAELEEAKKAYPEAFIRIIGFDNVRQVQCVSFIAYKP 181
>RBS0_SOLTU (P10647) Ribulose bisphosphate carboxylase small chain C,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit C) Length = 181 Score = 63.5 bits (153), Expect = 1e-10 Identities = 28/40 (70%), Positives = 34/40 (85%) Frame = -3 Query: 289 TQVLNEVEEVKKEYPXAYVRIIGFXNMRQVQCVSFIAFKP 170 TQVL EV+E K YP A++RIIGF N+RQVQC+SFIA+KP Sbjct: 139 TQVLAEVQEAKNAYPQAWIRIIGFDNVRQVQCISFIAYKP 178
>RBS3_MESCR (Q08183) Ribulose bisphosphate carboxylase small chain 3,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 3) Length = 183 Score = 63.2 bits (152), Expect = 2e-10 Identities = 27/40 (67%), Positives = 35/40 (87%) Frame = -3 Query: 289 TQVLNEVEEVKKEYPXAYVRIIGFXNMRQVQCVSFIAFKP 170 +QV+ E+EE KK YP A++RIIGF N+RQVQC+SFIA+KP Sbjct: 139 SQVVAELEEAKKAYPEAFIRIIGFDNVRQVQCISFIAYKP 178
>RBS_BETVE (Q96542) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 182 Score = 63.2 bits (152), Expect = 2e-10 Identities = 28/41 (68%), Positives = 34/41 (82%) Frame = -3 Query: 289 TQVLNEVEEVKKEYPXAYVRIIGFXNMRQVQCVSFIAFKPP 167 +QVL E+EE KK YP A++RIIGF N RQVQ +SFIA+KPP Sbjct: 140 SQVLKELEECKKAYPSAFIRIIGFDNKRQVQIISFIAYKPP 180
>RBS1_MESCR (P16032) Ribulose bisphosphate carboxylase small chain 1,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 1) Length = 182 Score = 63.2 bits (152), Expect = 2e-10 Identities = 27/40 (67%), Positives = 35/40 (87%) Frame = -3 Query: 289 TQVLNEVEEVKKEYPXAYVRIIGFXNMRQVQCVSFIAFKP 170 +QV+ E+EE KK YP A++RIIGF N+RQVQC+SFIA+KP Sbjct: 138 SQVVAELEEAKKAYPEAFIRIIGFDNVRQVQCISFIAYKP 177
>RBS_LACSA (Q40250) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 181 Score = 63.2 bits (152), Expect = 2e-10 Identities = 27/40 (67%), Positives = 33/40 (82%) Frame = -3 Query: 286 QVLNEVEEVKKEYPXAYVRIIGFXNMRQVQCVSFIAFKPP 167 QV+ EV E KKEYP A++R+IGF N+RQVQC+SFI KPP Sbjct: 139 QVMKEVGECKKEYPNAFIRVIGFDNIRQVQCISFIVAKPP 178
>RBS_FLATR (P07089) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 173 Score = 62.8 bits (151), Expect = 2e-10 Identities = 28/39 (71%), Positives = 34/39 (87%) Frame = -3 Query: 286 QVLNEVEEVKKEYPXAYVRIIGFXNMRQVQCVSFIAFKP 170 QV+ E++E KKEYP A++RIIGF N+RQVQCVSFIA KP Sbjct: 132 QVMKELQECKKEYPQAWIRIIGFDNVRQVQCVSFIASKP 170
>RBS_GLYTO (Q42822) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 178 Score = 62.8 bits (151), Expect = 2e-10 Identities = 26/41 (63%), Positives = 34/41 (82%) Frame = -3 Query: 289 TQVLNEVEEVKKEYPXAYVRIIGFXNMRQVQCVSFIAFKPP 167 +QVL E++E K YP ++RIIGF N+RQVQC+SFIA+KPP Sbjct: 136 SQVLKELQEAKTAYPNGFIRIIGFDNVRQVQCISFIAYKPP 176
>RBS4_SOYBN (P12468) Ribulose bisphosphate carboxylase small chain 4,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 4) Length = 178 Score = 62.8 bits (151), Expect = 2e-10 Identities = 26/41 (63%), Positives = 34/41 (82%) Frame = -3 Query: 289 TQVLNEVEEVKKEYPXAYVRIIGFXNMRQVQCVSFIAFKPP 167 +QVL E++E K YP ++RIIGF N+RQVQC+SFIA+KPP Sbjct: 136 SQVLKELQEAKTAYPNGFIRIIGFDNVRQVQCISFIAYKPP 176
>RBS1_SOYBN (P00865) Ribulose bisphosphate carboxylase small chain 1,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 1) Length = 178 Score = 62.8 bits (151), Expect = 2e-10 Identities = 26/41 (63%), Positives = 34/41 (82%) Frame = -3 Query: 289 TQVLNEVEEVKKEYPXAYVRIIGFXNMRQVQCVSFIAFKPP 167 +QVL E++E K YP ++RIIGF N+RQVQC+SFIA+KPP Sbjct: 136 SQVLKELQEAKTAYPNGFIRIIGFDNVRQVQCISFIAYKPP 176
>RBS7_FLAPR (Q39749) Ribulose bisphosphate carboxylase small chain 7,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 7) Length = 173 Score = 62.4 bits (150), Expect = 3e-10 Identities = 27/39 (69%), Positives = 34/39 (87%) Frame = -3 Query: 286 QVLNEVEEVKKEYPXAYVRIIGFXNMRQVQCVSFIAFKP 170 QV+ E++E KKEYP A++RIIGF N+RQVQC+SFIA KP Sbjct: 132 QVMKELQECKKEYPQAWIRIIGFDNVRQVQCISFIASKP 170
>RBS6_FLAPR (Q39748) Ribulose bisphosphate carboxylase small chain 6,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 6) Length = 173 Score = 62.4 bits (150), Expect = 3e-10 Identities = 27/39 (69%), Positives = 34/39 (87%) Frame = -3 Query: 286 QVLNEVEEVKKEYPXAYVRIIGFXNMRQVQCVSFIAFKP 170 QV+ E++E KKEYP A++RIIGF N+RQVQC+SFIA KP Sbjct: 132 QVMKELQECKKEYPQAWIRIIGFDNVRQVQCISFIASKP 170
>RBS5_FLAPR (Q39747) Ribulose bisphosphate carboxylase small chain 5,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 5) Length = 173 Score = 62.4 bits (150), Expect = 3e-10 Identities = 27/39 (69%), Positives = 34/39 (87%) Frame = -3 Query: 286 QVLNEVEEVKKEYPXAYVRIIGFXNMRQVQCVSFIAFKP 170 QV+ E++E KKEYP A++RIIGF N+RQVQC+SFIA KP Sbjct: 132 QVMKELQECKKEYPQAWIRIIGFDNVRQVQCISFIASKP 170
>RBS3_FLAPR (Q39745) Ribulose bisphosphate carboxylase small chain 3,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 3) Length = 173 Score = 62.4 bits (150), Expect = 3e-10 Identities = 27/39 (69%), Positives = 34/39 (87%) Frame = -3 Query: 286 QVLNEVEEVKKEYPXAYVRIIGFXNMRQVQCVSFIAFKP 170 QV+ E++E KKEYP A++RIIGF N+RQVQC+SFIA KP Sbjct: 132 QVMKELQECKKEYPQAWIRIIGFDNVRQVQCISFIASKP 170
>RBS1_FLAPR (Q39743) Ribulose bisphosphate carboxylase small chain 1,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 1) Length = 173 Score = 62.4 bits (150), Expect = 3e-10 Identities = 27/39 (69%), Positives = 34/39 (87%) Frame = -3 Query: 286 QVLNEVEEVKKEYPXAYVRIIGFXNMRQVQCVSFIAFKP 170 QV+ E++E KKEYP A++RIIGF N+RQVQC+SFIA KP Sbjct: 132 QVMKELQECKKEYPQAWIRIIGFDNVRQVQCISFIASKP 170
>RBS4_FLAPR (Q39746) Ribulose bisphosphate carboxylase small chain 4,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 4) Length = 178 Score = 62.4 bits (150), Expect = 3e-10 Identities = 27/39 (69%), Positives = 34/39 (87%) Frame = -3 Query: 286 QVLNEVEEVKKEYPXAYVRIIGFXNMRQVQCVSFIAFKP 170 QV+ E++E KKEYP A++RIIGF N+RQVQC+SFIA KP Sbjct: 137 QVMKELQECKKEYPQAWIRIIGFDNVRQVQCISFIASKP 175
>RBS2_FLAPR (Q39744) Ribulose bisphosphate carboxylase small chain 2,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 2) Length = 178 Score = 62.4 bits (150), Expect = 3e-10 Identities = 27/39 (69%), Positives = 34/39 (87%) Frame = -3 Query: 286 QVLNEVEEVKKEYPXAYVRIIGFXNMRQVQCVSFIAFKP 170 QV+ E++E KKEYP A++RIIGF N+RQVQC+SFIA KP Sbjct: 137 QVMKELQECKKEYPQAWIRIIGFDNVRQVQCISFIASKP 175
>RBS2_MESCR (Q04450) Ribulose bisphosphate carboxylase small chain 2,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 2) Length = 180 Score = 62.0 bits (149), Expect = 4e-10 Identities = 27/40 (67%), Positives = 34/40 (85%) Frame = -3 Query: 289 TQVLNEVEEVKKEYPXAYVRIIGFXNMRQVQCVSFIAFKP 170 +QV+ E+EE KK YP A+ RIIGF N+RQVQC+SFIA+KP Sbjct: 136 SQVVAELEEAKKAYPEAFTRIIGFDNVRQVQCISFIAYKP 175
>RBS1_LEMGI (P00872) Ribulose bisphosphate carboxylase small chain SSU1,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit SSU1) Length = 173 Score = 62.0 bits (149), Expect = 4e-10 Identities = 28/40 (70%), Positives = 33/40 (82%) Frame = -3 Query: 289 TQVLNEVEEVKKEYPXAYVRIIGFXNMRQVQCVSFIAFKP 170 +QV+ EVEE KK YP +VRIIGF N RQVQC+SFIA+KP Sbjct: 133 SQVIAEVEEAKKAYPEYFVRIIGFDNKRQVQCISFIAYKP 172
>RBS6_LEMGI (P19312) Ribulose bisphosphate carboxylase small chain SSU5B,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit SSU5B) Length = 177 Score = 62.0 bits (149), Expect = 4e-10 Identities = 28/40 (70%), Positives = 33/40 (82%) Frame = -3 Query: 289 TQVLNEVEEVKKEYPXAYVRIIGFXNMRQVQCVSFIAFKP 170 +QV+ EVEE KK YP +VRIIGF N RQVQC+SFIA+KP Sbjct: 137 SQVIAEVEEAKKAYPEYFVRIIGFDNKRQVQCISFIAYKP 176
>RBS5_LEMGI (P19311) Ribulose bisphosphate carboxylase small chain SSU5A,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit SSU5A) Length = 177 Score = 62.0 bits (149), Expect = 4e-10 Identities = 28/40 (70%), Positives = 33/40 (82%) Frame = -3 Query: 289 TQVLNEVEEVKKEYPXAYVRIIGFXNMRQVQCVSFIAFKP 170 +QV+ EVEE KK YP +VRIIGF N RQVQC+SFIA+KP Sbjct: 137 SQVIAEVEEAKKAYPEYFVRIIGFDNKRQVQCISFIAYKP 176
>RBS4_LEMGI (P19310) Ribulose bisphosphate carboxylase small chain SSU40B,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit SSU40B) Length = 177 Score = 62.0 bits (149), Expect = 4e-10 Identities = 28/40 (70%), Positives = 33/40 (82%) Frame = -3 Query: 289 TQVLNEVEEVKKEYPXAYVRIIGFXNMRQVQCVSFIAFKP 170 +QV+ EVEE KK YP +VRIIGF N RQVQC+SFIA+KP Sbjct: 137 SQVIAEVEEAKKAYPEYFVRIIGFDNKRQVQCISFIAYKP 176
>RBS3_LEMGI (P19309) Ribulose bisphosphate carboxylase small chain SSU40A,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit SSU40A) Length = 177 Score = 62.0 bits (149), Expect = 4e-10 Identities = 28/40 (70%), Positives = 33/40 (82%) Frame = -3 Query: 289 TQVLNEVEEVKKEYPXAYVRIIGFXNMRQVQCVSFIAFKP 170 +QV+ EVEE KK YP +VRIIGF N RQVQC+SFIA+KP Sbjct: 137 SQVIAEVEEAKKAYPEYFVRIIGFDNKRQVQCISFIAYKP 176
>RBS2_LEMGI (P19308) Ribulose bisphosphate carboxylase small chain SSU26,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit SSU26) Length = 177 Score = 62.0 bits (149), Expect = 4e-10 Identities = 28/40 (70%), Positives = 33/40 (82%) Frame = -3 Query: 289 TQVLNEVEEVKKEYPXAYVRIIGFXNMRQVQCVSFIAFKP 170 +QV+ EVEE KK YP +VRIIGF N RQVQC+SFIA+KP Sbjct: 137 SQVIAEVEEAKKAYPEYFVRIIGFDNKRQVQCISFIAYKP 176
>RBS_LARLA (P16031) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 189 Score = 60.5 bits (145), Expect = 1e-09 Identities = 26/40 (65%), Positives = 32/40 (80%) Frame = -3 Query: 289 TQVLNEVEEVKKEYPXAYVRIIGFXNMRQVQCVSFIAFKP 170 +QVLNEV E K YP A++R+IGF N+RQVQC+SFI KP Sbjct: 147 SQVLNEVNECAKAYPNAFIRVIGFDNVRQVQCISFIVHKP 186
>RBS_MANES (Q42915) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 182 Score = 60.1 bits (144), Expect = 1e-09 Identities = 25/40 (62%), Positives = 33/40 (82%) Frame = -3 Query: 286 QVLNEVEEVKKEYPXAYVRIIGFXNMRQVQCVSFIAFKPP 167 QVL E++E+ K +P Y RIIGF N+RQVQC+SF+A+KPP Sbjct: 141 QVLKELDELIKHHPDGYARIIGFDNVRQVQCISFLAYKPP 180
>RBS_PINTH (P10053) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 171 Score = 59.7 bits (143), Expect = 2e-09 Identities = 25/40 (62%), Positives = 32/40 (80%) Frame = -3 Query: 289 TQVLNEVEEVKKEYPXAYVRIIGFXNMRQVQCVSFIAFKP 170 +QV+NEV E K YP A++R+IGF N+RQVQC+SFI KP Sbjct: 131 SQVINEVRECAKAYPKAFIRVIGFDNVRQVQCISFIVHKP 170
>RBS1_SPIOL (P00870) Ribulose bisphosphate carboxylase small chain (EC| 4.1.1.39) (RuBisCO small subunit) Length = 123 Score = 59.7 bits (143), Expect = 2e-09 Identities = 27/39 (69%), Positives = 33/39 (84%) Frame = -3 Query: 286 QVLNEVEEVKKEYPXAYVRIIGFXNMRQVQCVSFIAFKP 170 QV+NEVEEVKK P A+VR IGF + R+VQC+SFIA+KP Sbjct: 82 QVVNEVEEVKKAPPDAFVRFIGFNDKREVQCISFIAYKP 120
>RBS5_FRIAG (O22645) Ribulose bisphosphate carboxylase small chain 5,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 5) Length = 179 Score = 59.3 bits (142), Expect = 2e-09 Identities = 26/39 (66%), Positives = 31/39 (79%) Frame = -3 Query: 286 QVLNEVEEVKKEYPXAYVRIIGFXNMRQVQCVSFIAFKP 170 QV+ E E KKEYP A++R+IGF N+RQVQCVSFI KP Sbjct: 140 QVVKEAAECKKEYPAAFIRVIGFDNVRQVQCVSFIVEKP 178
>RBS3_FRIAG (O22573) Ribulose bisphosphate carboxylase small chain 3,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 3) Length = 179 Score = 59.3 bits (142), Expect = 2e-09 Identities = 26/39 (66%), Positives = 31/39 (79%) Frame = -3 Query: 286 QVLNEVEEVKKEYPXAYVRIIGFXNMRQVQCVSFIAFKP 170 QV+ E E KKEYP A++R+IGF N+RQVQCVSFI KP Sbjct: 140 QVVKEAAECKKEYPAAFIRVIGFDNVRQVQCVSFIVEKP 178
>RBS2_FRIAG (O22572) Ribulose bisphosphate carboxylase small chain 2,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 2) Length = 179 Score = 59.3 bits (142), Expect = 2e-09 Identities = 26/39 (66%), Positives = 31/39 (79%) Frame = -3 Query: 286 QVLNEVEEVKKEYPXAYVRIIGFXNMRQVQCVSFIAFKP 170 QV+ E E KKEYP A++R+IGF N+RQVQCVSFI KP Sbjct: 140 QVVKEAAECKKEYPAAFIRVIGFDNVRQVQCVSFIVEKP 178
>RBS_TRIRP (P17673) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 178 Score = 58.9 bits (141), Expect = 3e-09 Identities = 27/39 (69%), Positives = 31/39 (79%) Frame = -3 Query: 286 QVLNEVEEVKKEYPXAYVRIIGFXNMRQVQCVSFIAFKP 170 QVL EV E K EYP A++RIIGF N+RQVQC+SFIA P Sbjct: 137 QVLKEVAECKAEYPEAFIRIIGFDNVRQVQCISFIASTP 175
>RBS_HEVBR (P29684) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 183 Score = 58.9 bits (141), Expect = 3e-09 Identities = 26/43 (60%), Positives = 33/43 (76%) Frame = -3 Query: 286 QVLNEVEEVKKEYPXAYVRIIGFXNMRQVQCVSFIAFKPPXCE 158 QVL E++E+ K YP Y RIIGF N+RQVQC+SF+A+KP E Sbjct: 141 QVLQELDEMIKAYPDCYGRIIGFDNVRQVQCISFLAYKPKGAE 183
>RBS_MAIZE (P05348) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 170 Score = 58.5 bits (140), Expect = 4e-09 Identities = 25/41 (60%), Positives = 32/41 (78%) Frame = -3 Query: 289 TQVLNEVEEVKKEYPXAYVRIIGFXNMRQVQCVSFIAFKPP 167 TQV E++E K YP A+ R+IGF N++Q QCVSFIA+KPP Sbjct: 127 TQVYKELQEAIKSYPDAFHRVIGFDNIKQTQCVSFIAYKPP 167
>RBS_HELAN (P08705) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 178 Score = 58.2 bits (139), Expect = 5e-09 Identities = 25/39 (64%), Positives = 32/39 (82%) Frame = -3 Query: 286 QVLNEVEEVKKEYPXAYVRIIGFXNMRQVQCVSFIAFKP 170 QV+ E+ E KKEYP A++RIIGF N+RQVQC+ FIA +P Sbjct: 137 QVMKELAECKKEYPQAWIRIIGFDNVRQVQCIMFIASRP 175
>RBS1_FRIAG (O24634) Ribulose bisphosphate carboxylase small chain 1/4,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 1/4) Length = 179 Score = 58.2 bits (139), Expect = 5e-09 Identities = 25/39 (64%), Positives = 31/39 (79%) Frame = -3 Query: 286 QVLNEVEEVKKEYPXAYVRIIGFXNMRQVQCVSFIAFKP 170 QV+ E E KKEYP A++R+IGF N+RQVQCVSFI +P Sbjct: 140 QVVKEAAECKKEYPAAFIRVIGFDNVRQVQCVSFIVERP 178
>RBS_SILPR (P18960) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 177 Score = 57.8 bits (138), Expect = 7e-09 Identities = 27/40 (67%), Positives = 31/40 (77%) Frame = -3 Query: 289 TQVLNEVEEVKKEYPXAYVRIIGFXNMRQVQCVSFIAFKP 170 +QV EV E K YP A+VRIIGF N RQVQC+SFIA+KP Sbjct: 137 SQVAAEVVECKNAYPDAHVRIIGFDNKRQVQCISFIAYKP 176
>RBS3_PEA (P07689) Ribulose bisphosphate carboxylase small chain 3A,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 3A) Length = 180 Score = 57.0 bits (136), Expect = 1e-08 Identities = 26/40 (65%), Positives = 32/40 (80%) Frame = -3 Query: 289 TQVLNEVEEVKKEYPXAYVRIIGFXNMRQVQCVSFIAFKP 170 +QVL E++EV YP A+VRIIGF N+RQVQC+SFIA P Sbjct: 138 SQVLKELDEVVAAYPQAFVRIIGFDNVRQVQCISFIAHTP 177
>RBS2_PEA (P00869) Ribulose bisphosphate carboxylase small chain 3C,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 3C) (PSS15) Length = 180 Score = 57.0 bits (136), Expect = 1e-08 Identities = 26/40 (65%), Positives = 32/40 (80%) Frame = -3 Query: 289 TQVLNEVEEVKKEYPXAYVRIIGFXNMRQVQCVSFIAFKP 170 +QVL E++EV YP A+VRIIGF N+RQVQC+SFIA P Sbjct: 138 SQVLKELDEVVAAYPQAFVRIIGFDNVRQVQCISFIAHTP 177
>RBS_MEDSA (O65194) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 180 Score = 56.2 bits (134), Expect = 2e-08 Identities = 24/40 (60%), Positives = 32/40 (80%) Frame = -3 Query: 289 TQVLNEVEEVKKEYPXAYVRIIGFXNMRQVQCVSFIAFKP 170 +QVL E+ + K EYP +++RIIGF N+RQVQC+SFIA P Sbjct: 138 SQVLKELADCKAEYPDSFIRIIGFDNVRQVQCISFIAHTP 177
>RBS1_PEA (P00868) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) (PSSU1) (Fragment) Length = 136 Score = 56.2 bits (134), Expect = 2e-08 Identities = 25/39 (64%), Positives = 31/39 (79%) Frame = -3 Query: 286 QVLNEVEEVKKEYPXAYVRIIGFXNMRQVQCVSFIAFKP 170 QV+ EV+EV YP A+VR+IGF N+RQVQC+SFIA P Sbjct: 95 QVVKEVDEVVAAYPEAFVRVIGFNNVRQVQCISFIAHTP 133
>RBS_ZANAE (O48550) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 178 Score = 55.1 bits (131), Expect = 5e-08 Identities = 24/40 (60%), Positives = 30/40 (75%) Frame = -3 Query: 289 TQVLNEVEEVKKEYPXAYVRIIGFXNMRQVQCVSFIAFKP 170 +QVL EV+E K YP + RIIGF N RQVQC+SF+ +KP Sbjct: 136 SQVLKEVDECSKAYPDYFNRIIGFDNTRQVQCISFLTYKP 175
>RBS_SYNP2 (Q44178) Ribulose bisphosphate carboxylase small chain (EC| 4.1.1.39) (RuBisCO small subunit) Length = 111 Score = 52.0 bits (123), Expect = 4e-07 Identities = 21/39 (53%), Positives = 29/39 (74%) Frame = -3 Query: 286 QVLNEVEEVKKEYPXAYVRIIGFXNMRQVQCVSFIAFKP 170 +VLNEV E + EY Y+R++GF N++Q Q VSFI +KP Sbjct: 68 EVLNEVRECRSEYSDCYIRVVGFDNIKQCQTVSFIVYKP 106
>RBS_PROHO (P27569) Ribulose bisphosphate carboxylase small chain (EC| 4.1.1.39) (RuBisCO small subunit) Length = 109 Score = 50.8 bits (120), Expect = 9e-07 Identities = 21/39 (53%), Positives = 28/39 (71%) Frame = -3 Query: 286 QVLNEVEEVKKEYPXAYVRIIGFXNMRQVQCVSFIAFKP 170 +VL EV E + EYP Y+R++GF N++Q Q VSFI KP Sbjct: 68 EVLGEVRECRTEYPNCYIRVVGFDNIKQCQSVSFIVHKP 106
>RBS_SYNY3 (P54206) Ribulose bisphosphate carboxylase small chain (EC| 4.1.1.39) (RuBisCO small subunit) Length = 113 Score = 47.4 bits (111), Expect = 1e-05 Identities = 21/39 (53%), Positives = 27/39 (69%) Frame = -3 Query: 286 QVLNEVEEVKKEYPXAYVRIIGFXNMRQVQCVSFIAFKP 170 +VL EV E + E P Y+R+IGF N++Q Q VSFI KP Sbjct: 68 EVLAEVRECRSENPNCYIRVIGFDNIKQCQTVSFIVHKP 106
>RBS_SYNP6 (P04716) Ribulose bisphosphate carboxylase small chain (EC| 4.1.1.39) (RuBisCO small subunit) Length = 110 Score = 46.6 bits (109), Expect = 2e-05 Identities = 20/39 (51%), Positives = 27/39 (69%) Frame = -3 Query: 286 QVLNEVEEVKKEYPXAYVRIIGFXNMRQVQCVSFIAFKP 170 QVL+EV E + EY Y+R+ GF N++Q Q VSFI +P Sbjct: 69 QVLDEVRECRSEYGDCYIRVAGFDNIKQCQTVSFIVHRP 107
>RBS_CYAPA (P18062) Ribulose bisphosphate carboxylase small chain (EC| 4.1.1.39) (RuBisCO small subunit) Length = 106 Score = 46.6 bits (109), Expect = 2e-05 Identities = 16/39 (41%), Positives = 31/39 (79%) Frame = -3 Query: 286 QVLNEVEEVKKEYPXAYVRIIGFXNMRQVQCVSFIAFKP 170 +VL+E++ K+++P AY+R++ F ++RQVQ + F+ +KP Sbjct: 67 EVLSEIQACKQQFPNAYIRVVAFDSIRQVQTLMFLVYKP 105
>RBS_ANASP (P06514) Ribulose bisphosphate carboxylase small chain (EC| 4.1.1.39) (RuBisCO small subunit) Length = 109 Score = 46.2 bits (108), Expect = 2e-05 Identities = 18/39 (46%), Positives = 28/39 (71%) Frame = -3 Query: 286 QVLNEVEEVKKEYPXAYVRIIGFXNMRQVQCVSFIAFKP 170 +VL EV+ + +YP Y+R++GF N++Q Q +SFI KP Sbjct: 68 EVLAEVQSCRSQYPGHYIRVVGFDNIKQCQILSFIVHKP 106
>RBS_MARPA (O64416) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 180 Score = 45.4 bits (106), Expect = 4e-05 Identities = 22/39 (56%), Positives = 26/39 (66%), Gaps = 1/39 (2%) Frame = -3 Query: 283 VLNEVEEVKKEY-PXAYVRIIGFXNMRQVQCVSFIAFKP 170 VL E+EE KK Y Y+R +GF N RQVQC SFI +P Sbjct: 140 VLREIEECKKLYGKKCYIRCLGFDNTRQVQCASFIVHQP 178
>RBS_EUGGR (P16881) Ribulose bisphosphate carboxylase small chains, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunits) [Contains: Ribulose bisphosphate carboxylase small chain P1; Ribulose bisphosphate carboxylase small chain P2; Ribulose bispho Length = 1273 Score = 44.7 bits (104), Expect = 6e-05 Identities = 18/46 (39%), Positives = 29/46 (63%) Frame = -3 Query: 289 TQVLNEVEEVKKEYPXAYVRIIGFXNMRQVQCVSFIAFKPPXCEES 152 +QVL E+ E ++ YP YVR+ F +++QVQ +SF+ +P S Sbjct: 1083 SQVLREISECRRAYPQCYVRLAAFDSVKQVQVISFVVQRPSGSSSS 1128 Score = 44.7 bits (104), Expect = 6e-05 Identities = 18/46 (39%), Positives = 29/46 (63%) Frame = -3 Query: 289 TQVLNEVEEVKKEYPXAYVRIIGFXNMRQVQCVSFIAFKPPXCEES 152 +QVL E+ E ++ YP YVR+ F +++QVQ +SF+ +P S Sbjct: 795 SQVLREISECRRAYPQCYVRLAAFDSVKQVQVISFVVQRPSGSSSS 840 Score = 44.7 bits (104), Expect = 6e-05 Identities = 18/46 (39%), Positives = 29/46 (63%) Frame = -3 Query: 289 TQVLNEVEEVKKEYPXAYVRIIGFXNMRQVQCVSFIAFKPPXCEES 152 +QVL E+ E ++ YP YVR+ F +++QVQ +SF+ +P S Sbjct: 652 SQVLREISECRRAYPQCYVRLAAFDSVKQVQVISFVVQRPSGSSSS 697 Score = 44.7 bits (104), Expect = 6e-05 Identities = 18/46 (39%), Positives = 29/46 (63%) Frame = -3 Query: 289 TQVLNEVEEVKKEYPXAYVRIIGFXNMRQVQCVSFIAFKPPXCEES 152 +QVL E+ E ++ YP YVR+ F +++QVQ +SF+ +P S Sbjct: 508 SQVLREISECRRAYPQCYVRLAAFDSVKQVQVISFVVQRPSGSSSS 553 Score = 44.7 bits (104), Expect = 6e-05 Identities = 18/46 (39%), Positives = 29/46 (63%) Frame = -3 Query: 289 TQVLNEVEEVKKEYPXAYVRIIGFXNMRQVQCVSFIAFKPPXCEES 152 +QVL E+ E ++ YP YVR+ F +++QVQ +SF+ +P S Sbjct: 365 SQVLREISECRRAYPQCYVRLAAFDSVKQVQVISFVVQRPSGSSSS 410 Score = 44.7 bits (104), Expect = 6e-05 Identities = 18/46 (39%), Positives = 29/46 (63%) Frame = -3 Query: 289 TQVLNEVEEVKKEYPXAYVRIIGFXNMRQVQCVSFIAFKPPXCEES 152 +QVL E+ E ++ YP YVR+ F +++QVQ +SF+ +P S Sbjct: 221 SQVLREISECRRAYPQCYVRLAAFDSVKQVQVISFVVQRPSGSSSS 266 Score = 44.3 bits (103), Expect = 8e-05 Identities = 17/40 (42%), Positives = 28/40 (70%) Frame = -3 Query: 289 TQVLNEVEEVKKEYPXAYVRIIGFXNMRQVQCVSFIAFKP 170 +QVL E+ E ++ YP YVR+ F +++QVQ +SF+ +P Sbjct: 1227 SQVLREISECRRAYPQCYVRLAAFDSVKQVQVISFVVQRP 1266 Score = 40.4 bits (93), Expect = 0.001 Identities = 18/46 (39%), Positives = 29/46 (63%) Frame = -3 Query: 289 TQVLNEVEEVKKEYPXAYVRIIGFXNMRQVQCVSFIAFKPPXCEES 152 +QVL E+ E ++ YP YVR + F +++QVQ +SF+ +P S Sbjct: 940 SQVLREISECRRAYPQCYVR-LAFDSVKQVQVISFVVQRPSGSSSS 984
>RBS_CHLMO (P17537) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 168 Score = 43.5 bits (101), Expect = 1e-04 Identities = 17/45 (37%), Positives = 28/45 (62%) Frame = -3 Query: 289 TQVLNEVEEVKKEYPXAYVRIIGFXNMRQVQCVSFIAFKPPXCEE 155 +QVL EV + +P Y+R++ F N++QVQC+ F+ +P E Sbjct: 115 SQVLREVSACQVAFPNVYIRLVAFDNVKQVQCMGFLVQRPRNAAE 159
>RBS3_ACECL (P16131) Ribulose bisphosphate carboxylase small chain 3,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 3) Length = 183 Score = 42.0 bits (97), Expect = 4e-04 Identities = 17/45 (37%), Positives = 28/45 (62%) Frame = -3 Query: 289 TQVLNEVEEVKKEYPXAYVRIIGFXNMRQVQCVSFIAFKPPXCEE 155 +QVL+E++ K +P AY+R++ F RQVQ F+ +PP + Sbjct: 130 SQVLSEIQACTKAFPDAYIRLVCFDANRQVQISGFLVHRPPSATD 174
>RBS2_ACEME (P16135) Ribulose bisphosphate carboxylase small chain 2,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 2) (Fragment) Length = 173 Score = 42.0 bits (97), Expect = 4e-04 Identities = 17/45 (37%), Positives = 28/45 (62%) Frame = -3 Query: 289 TQVLNEVEEVKKEYPXAYVRIIGFXNMRQVQCVSFIAFKPPXCEE 155 +QVL+E++ K +P AY+R++ F RQVQ F+ +PP + Sbjct: 120 SQVLSEIQACTKAFPDAYIRLVCFDANRQVQISGFLVHRPPSATD 164
>RBS4_ACECL (P16132) Ribulose bisphosphate carboxylase small chain 4,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 4) Length = 182 Score = 42.0 bits (97), Expect = 4e-04 Identities = 17/45 (37%), Positives = 28/45 (62%) Frame = -3 Query: 289 TQVLNEVEEVKKEYPXAYVRIIGFXNMRQVQCVSFIAFKPPXCEE 155 +QVL+E++ K +P AY+R++ F RQVQ F+ +PP + Sbjct: 129 SQVLSEIQACTKAFPDAYIRLVCFDANRQVQISGFLVHRPPSATD 173
>RBS3_ACEME (P16136) Ribulose bisphosphate carboxylase small chain 3,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 3) Length = 182 Score = 42.0 bits (97), Expect = 4e-04 Identities = 17/45 (37%), Positives = 28/45 (62%) Frame = -3 Query: 289 TQVLNEVEEVKKEYPXAYVRIIGFXNMRQVQCVSFIAFKPPXCEE 155 +QVL+E++ K +P AY+R++ F RQVQ F+ +PP + Sbjct: 129 SQVLSEIQACTKAFPDAYIRLVCFDANRQVQISGFLVHRPPSATD 173
>RBS1_ACEME (P16134) Ribulose bisphosphate carboxylase small chain 1,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 1) Length = 182 Score = 42.0 bits (97), Expect = 4e-04 Identities = 17/45 (37%), Positives = 28/45 (62%) Frame = -3 Query: 289 TQVLNEVEEVKKEYPXAYVRIIGFXNMRQVQCVSFIAFKPPXCEE 155 +QVL+E++ K +P AY+R++ F RQVQ F+ +PP + Sbjct: 129 SQVLSEIQACTKAFPDAYIRLVCFDANRQVQISGFLVHRPPSATD 173
>RBS2_ACECL (P16130) Ribulose bisphosphate carboxylase small chain 2 (EC| 4.1.1.39) (RuBisCO small subunit 2) (Fragment) Length = 86 Score = 42.0 bits (97), Expect = 4e-04 Identities = 17/45 (37%), Positives = 28/45 (62%) Frame = -3 Query: 289 TQVLNEVEEVKKEYPXAYVRIIGFXNMRQVQCVSFIAFKPPXCEE 155 +QVL+E++ K +P AY+R++ F RQVQ F+ +PP + Sbjct: 33 SQVLSEIQACTKAFPDAYIRLVCFDANRQVQISGFLVHRPPSATD 77
>RBS1_ACECL (P16129) Ribulose bisphosphate carboxylase small chain 1 (EC| 4.1.1.39) (RuBisCO small subunit 1) (Fragment) Length = 126 Score = 42.0 bits (97), Expect = 4e-04 Identities = 17/45 (37%), Positives = 28/45 (62%) Frame = -3 Query: 289 TQVLNEVEEVKKEYPXAYVRIIGFXNMRQVQCVSFIAFKPPXCEE 155 +QVL+E++ K +P AY+R++ F RQVQ F+ +PP + Sbjct: 73 SQVLSEIQACTKAFPDAYIRLVCFDANRQVQISGFLVHRPPSATD 117
>RBS5_ACECL (P16133) Ribulose bisphosphate carboxylase small chain 5,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 5) Length = 184 Score = 42.0 bits (97), Expect = 4e-04 Identities = 17/45 (37%), Positives = 28/45 (62%) Frame = -3 Query: 289 TQVLNEVEEVKKEYPXAYVRIIGFXNMRQVQCVSFIAFKPPXCEE 155 +QVL+E++ K +P AY+R++ F RQVQ F+ +PP + Sbjct: 131 SQVLSEIQACTKAFPDAYIRLVCFDANRQVQISGFLVHRPPTATD 175
>RBS6_ACECL (Q38692) Ribulose bisphosphate carboxylase small chain 6,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 6) (rbcS4) Length = 182 Score = 41.6 bits (96), Expect = 5e-04 Identities = 17/45 (37%), Positives = 27/45 (60%) Frame = -3 Query: 289 TQVLNEVEEVKKEYPXAYVRIIGFXNMRQVQCVSFIAFKPPXCEE 155 +QVL E++ K +P AY+R++ F RQVQ F+ +PP + Sbjct: 129 SQVLTEIQACTKAFPDAYIRLVCFDANRQVQISGFLVHRPPSATD 173
>RBS2_CHLRE (P08475) Ribulose bisphosphate carboxylase small chain 2,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 2) Length = 185 Score = 41.6 bits (96), Expect = 5e-04 Identities = 17/44 (38%), Positives = 26/44 (59%) Frame = -3 Query: 286 QVLNEVEEVKKEYPXAYVRIIGFXNMRQVQCVSFIAFKPPXCEE 155 QVL E+ K +P AYVR++ F N +QVQ + F+ +P + Sbjct: 133 QVLREIVACTKAFPDAYVRLVAFDNQKQVQIMGFLVQRPKSARD 176
>RBS1_CHLRE (P00873) Ribulose bisphosphate carboxylase small chain 1,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 1) Length = 185 Score = 41.6 bits (96), Expect = 5e-04 Identities = 17/44 (38%), Positives = 26/44 (59%) Frame = -3 Query: 286 QVLNEVEEVKKEYPXAYVRIIGFXNMRQVQCVSFIAFKPPXCEE 155 QVL E+ K +P AYVR++ F N +QVQ + F+ +P + Sbjct: 133 QVLREIVACTKAFPDAYVRLVAFDNQKQVQIMGFLVQRPKTARD 176
>RBS7_ACECL (Q38693) Ribulose bisphosphate carboxylase small chain 7,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 7) (rbcS1) Length = 183 Score = 40.4 bits (93), Expect = 0.001 Identities = 16/45 (35%), Positives = 28/45 (62%) Frame = -3 Query: 289 TQVLNEVEEVKKEYPXAYVRIIGFXNMRQVQCVSFIAFKPPXCEE 155 +QVL++++ K +P AY+R++ F RQVQ F+ +PP + Sbjct: 130 SQVLSDMQACTKAFPDAYIRLVCFDANRQVQICGFLVHRPPSATD 174
>RBS5_ACEME (P16138) Ribulose bisphosphate carboxylase small chain 5,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 5) Length = 183 Score = 40.0 bits (92), Expect = 0.002 Identities = 16/45 (35%), Positives = 27/45 (60%) Frame = -3 Query: 289 TQVLNEVEEVKKEYPXAYVRIIGFXNMRQVQCVSFIAFKPPXCEE 155 +QVL+E++ +P AY+R++ F RQVQ F+ +PP + Sbjct: 130 SQVLSEIQACTNAFPDAYIRLVCFDANRQVQISGFLVHRPPSATD 174
>RBS4_ACEME (P16137) Ribulose bisphosphate carboxylase small chain 4,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 4) Length = 182 Score = 40.0 bits (92), Expect = 0.002 Identities = 16/45 (35%), Positives = 27/45 (60%) Frame = -3 Query: 289 TQVLNEVEEVKKEYPXAYVRIIGFXNMRQVQCVSFIAFKPPXCEE 155 +QVL+E++ +P AY+R++ F RQVQ F+ +PP + Sbjct: 129 SQVLSEIQACTNAFPDAYIRLVCFDANRQVQISGFLVHRPPSATD 173
>RBS_SACHY (Q41373) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 168 Score = 37.7 bits (86), Expect = 0.008 Identities = 19/44 (43%), Positives = 27/44 (61%) Frame = -3 Query: 289 TQVLNEVEEVKKEYPXAYVRIIGFXNMRQVQCVSFIAFKPPXCE 158 +QV E++E YP I+GF N+RQ Q ++FIA+KP E Sbjct: 126 SQVYKELQEAIASYPELRA-ILGFDNIRQTQWLTFIAYKPAGSE 168
>RBS_BATOE (P26985) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 175 Score = 37.7 bits (86), Expect = 0.008 Identities = 16/40 (40%), Positives = 24/40 (60%) Frame = -3 Query: 289 TQVLNEVEEVKKEYPXAYVRIIGFXNMRQVQCVSFIAFKP 170 +QVL E+ K +P AY+R++ F RQVQ F+ +P Sbjct: 122 SQVLTEISACTKAFPDAYIRLVCFDANRQVQISGFLVHRP 161
>RBS2_CHRVI (P22860) Ribulose bisphosphate carboxylase small chain 2 (EC| 4.1.1.39) (RuBisCO small subunit 2) Length = 113 Score = 34.7 bits (78), Expect = 0.064 Identities = 13/38 (34%), Positives = 24/38 (63%) Frame = -3 Query: 283 VLNEVEEVKKEYPXAYVRIIGFXNMRQVQCVSFIAFKP 170 +L E+E ++ YP +VR++G+ Q + SF+A +P Sbjct: 75 ILTEIESCRRSYPDHHVRLVGYDTYAQSKGHSFLAHRP 112
>RBS_PSEHY (Q51857) Ribulose bisphosphate carboxylase small chain (EC| 4.1.1.39) (RuBisCO small subunit) Length = 124 Score = 33.9 bits (76), Expect = 0.11 Identities = 11/39 (28%), Positives = 25/39 (64%) Frame = -3 Query: 286 QVLNEVEEVKKEYPXAYVRIIGFXNMRQVQCVSFIAFKP 170 +++ E+E K+ P +++IG+ N+RQ Q + + ++P Sbjct: 84 KIIAEIEACKRSNPNHLIKLIGYDNIRQTQGTAMLVYRP 122
>RBS2_THIFE (Q07088) Ribulose bisphosphate carboxylase small chain 2 (EC| 4.1.1.39) (RuBisCO small subunit 2) Length = 118 Score = 32.7 bits (73), Expect = 0.24 Identities = 13/37 (35%), Positives = 21/37 (56%) Frame = -3 Query: 283 VLNEVEEVKKEYPXAYVRIIGFXNMRQVQCVSFIAFK 173 +L E E K P +VRI+G+ N +Q Q S + ++ Sbjct: 78 ILKEAERCHKRNPHNHVRIVGYDNFKQSQGTSLVVYR 114
>RBS_SYNPX (P0A4S5) Ribulose bisphosphate carboxylase small chain (EC| 4.1.1.39) (RuBisCO small subunit) Length = 113 Score = 30.8 bits (68), Expect = 0.92 Identities = 13/37 (35%), Positives = 22/37 (59%) Frame = -3 Query: 283 VLNEVEEVKKEYPXAYVRIIGFXNMRQVQCVSFIAFK 173 V++E+E + YP +VRI+G+ Q Q F+ F+ Sbjct: 75 VVSELEACHRAYPDHHVRIVGYDAYTQSQGACFVVFE 111
>RBS_SYNPW (P0A4S6) Ribulose bisphosphate carboxylase small chain (EC| 4.1.1.39) (RuBisCO small subunit) Length = 113 Score = 30.8 bits (68), Expect = 0.92 Identities = 13/37 (35%), Positives = 22/37 (59%) Frame = -3 Query: 283 VLNEVEEVKKEYPXAYVRIIGFXNMRQVQCVSFIAFK 173 V++E+E + YP +VRI+G+ Q Q F+ F+ Sbjct: 75 VVSELEACHRAYPDHHVRIVGYDAYTQSQGACFVVFE 111
>RBS_CYAME (O22024) Ribulose bisphosphate carboxylase small chain (EC| 4.1.1.39) (RuBisCO small subunit) Length = 138 Score = 30.8 bits (68), Expect = 0.92 Identities = 11/40 (27%), Positives = 27/40 (67%), Gaps = 2/40 (5%) Frame = -3 Query: 283 VLNEVEEVKKEYPXAYVRIIGFXNMRQVQ--CVSFIAFKP 170 ++ EV+E +K++P Y++++ F + + ++ +SFI +P Sbjct: 64 IMFEVQECRKQFPNHYIKVLAFNSTKGIESTALSFIVNRP 103
>RBS2_HYDMR (Q59461) Ribulose bisphosphate carboxylase small chain 2 (EC| 4.1.1.39) (RuBisCO small subunit 2) Length = 122 Score = 30.4 bits (67), Expect = 1.2 Identities = 13/36 (36%), Positives = 21/36 (58%) Frame = -3 Query: 283 VLNEVEEVKKEYPXAYVRIIGFXNMRQVQCVSFIAF 176 VL E+++ + YP +R+IG+ N Q Q +F F Sbjct: 73 VLAEIDQCRAAYPNHMIRLIGYDNYTQCQGHNFCRF 108
>RBS_NITVU (Q59614) Ribulose bisphosphate carboxylase small chain (EC| 4.1.1.39) (RuBisCO small subunit) Length = 108 Score = 30.0 bits (66), Expect = 1.6 Identities = 11/37 (29%), Positives = 22/37 (59%) Frame = -3 Query: 283 VLNEVEEVKKEYPXAYVRIIGFXNMRQVQCVSFIAFK 173 V+ E+E +E+P VR + + N Q Q ++F+ ++ Sbjct: 72 VVAEIEACHREFPDQMVRFVAYDNYAQSQGMAFVVYR 108
>RBS2_RHIME (P56890) Ribulose bisphosphate carboxylase small chain (EC| 4.1.1.39) (RuBisCO small subunit) Length = 129 Score = 30.0 bits (66), Expect = 1.6 Identities = 15/40 (37%), Positives = 25/40 (62%), Gaps = 2/40 (5%) Frame = -3 Query: 283 VLNEVEEVKKEYPXAYVRIIGFXNMRQVQCV--SFIAFKP 170 V+ EVE+ +K +P Y+R+ F + R ++ V SFI +P Sbjct: 64 VMMEVEDCRKAHPQDYIRLNAFDSSRGLETVTMSFIVNRP 103
>RBS_THINE (P45686) Ribulose bisphosphate carboxylase small chain (EC| 4.1.1.39) (RuBisCO small subunit) Length = 110 Score = 27.7 bits (60), Expect = 7.8 Identities = 10/37 (27%), Positives = 21/37 (56%) Frame = -3 Query: 283 VLNEVEEVKKEYPXAYVRIIGFXNMRQVQCVSFIAFK 173 VL E+E + YP V+++ + N Q ++F+ ++ Sbjct: 72 VLAEIEACRSAYPTHQVKLVAYDNYAQSLGLAFVVYR 108
>ENGC_PROMA (Q7VEJ4) Probable GTPase engC (EC 3.6.1.-)| Length = 309 Score = 27.7 bits (60), Expect = 7.8 Identities = 14/38 (36%), Positives = 19/38 (50%) Frame = +2 Query: 20 TYTYS*EQIRKINGEGKPKAMSELTKLQWHFXCGPSSV 133 T+ Y I +NGEG K + L ++ CGPS V Sbjct: 156 TWGYQPIPISIVNGEGIQKLSARLKSMKLGVLCGPSGV 193 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 32,073,963 Number of Sequences: 219361 Number of extensions: 468021 Number of successful extensions: 1230 Number of sequences better than 10.0: 124 Number of HSP's better than 10.0 without gapping: 1036 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1226 length of database: 80,573,946 effective HSP length: 72 effective length of database: 64,779,954 effective search space used: 1554718896 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)