Clone Name | rbasd27c19 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | GT2D1_MOUSE (Q9JI57) General transcription factor II-I repeat do... | 31 | 3.6 | 2 | POMT2_HUMAN (Q9UKY4) Protein O-mannosyl-transferase 2 (EC 2.4.1.... | 31 | 3.6 |
---|
>GT2D1_MOUSE (Q9JI57) General transcription factor II-I repeat domain-containing| protein 1 (GTF2I repeat domain-containing protein 1) (Binding factor for early enhancer) Length = 1104 Score = 30.8 bits (68), Expect = 3.6 Identities = 23/83 (27%), Positives = 34/83 (40%), Gaps = 1/83 (1%) Frame = -2 Query: 590 KILSVGHVSYEVLLPVRFI-DMWEPAVLAIKREGYSIKCNGQRGVVITEKFQQATAINIP 414 KIL+ GH + + P R D W+P R G + Q + EK+ +A +N P Sbjct: 776 KILTTGHEAGKTTRPRRLQQDTWQPDEDDANRLGEKVILREQVKELFNEKYGEALGLNRP 835 Query: 413 YGHPTEFSIQSADGAEYNLKPGE 345 P + S D E P + Sbjct: 836 VLVPYKLIRDSPDAVEVKGLPDD 858
>POMT2_HUMAN (Q9UKY4) Protein O-mannosyl-transferase 2 (EC 2.4.1.109)| (Dolichyl-phosphate-mannose--protein mannosyltransferase 2) Length = 750 Score = 30.8 bits (68), Expect = 3.6 Identities = 18/61 (29%), Positives = 33/61 (54%), Gaps = 1/61 (1%) Frame = -2 Query: 638 EQRKITCDPEMKELIKKILSV-GHVSYEVLLPVRFIDMWEPAVLAIKREGYSIKCNGQRG 462 EQ ++TC P +KE + I +V H++ + LP +D+ +P+ I E + + G G Sbjct: 498 EQLEVTCTPYLKETLNSIWNVEDHINPK--LPNISLDVLQPSFPEILLESHMVMIRGNSG 555 Query: 461 V 459 + Sbjct: 556 L 556 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 85,974,014 Number of Sequences: 219361 Number of extensions: 1691626 Number of successful extensions: 3872 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3795 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3871 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 5995743495 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)