Clone Name | rbasd26m18 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | YCY3_SCHPO (O74840) Hypothetical protein C1235.03 in chromosome III | 33 | 0.71 | 2 | SRY_APOAG (O55063) Sex-determining region Y protein (Testis-dete... | 30 | 7.9 | 3 | SPRC_RABIT (P36233) SPARC precursor (Secreted protein acidic and... | 30 | 7.9 |
---|
>YCY3_SCHPO (O74840) Hypothetical protein C1235.03 in chromosome III| Length = 399 Score = 33.1 bits (74), Expect = 0.71 Identities = 25/91 (27%), Positives = 41/91 (45%) Frame = -2 Query: 619 VRADVHQRQVHYRLDKKVARREGEVMSTQQKCPLPDKNGWLVEEVMTLEAPYSIPVGAEF 440 ++ H + +L + A+ STQ K L D++ LVE+ L A + E+ Sbjct: 191 IKETQHNEMGNIKLSSQTAKSNS---STQTKTCLNDQSSKLVEDDEALSAEDCNRLAEEY 247 Query: 439 VQAEVMQCPSIYWHGMAKELQESKEDHARGG 347 ++ MQ + AKE + SK +H GG Sbjct: 248 LELRNMQ-----YSNSAKEYRRSKSNHLFGG 273
>SRY_APOAG (O55063) Sex-determining region Y protein (Testis-determining| factor) (Fragment) Length = 57 Score = 29.6 bits (65), Expect = 7.9 Identities = 16/45 (35%), Positives = 22/45 (48%) Frame = -3 Query: 399 MAWLKSCKNRKKITQEVASKLSSRLKKIFGQLEKELVPAN*EPFF 265 M W SC R+K+ Q+ S ++ + K G K L A PFF Sbjct: 6 MVW--SCGERRKLAQQNPSMQNTEISKQLGYRWKSLTEAEKRPFF 48
>SPRC_RABIT (P36233) SPARC precursor (Secreted protein acidic and rich in| cysteine) (Osteonectin) (ON) (Basement-membrane protein 40) (BM-40) (Fragment) Length = 273 Score = 29.6 bits (65), Expect = 7.9 Identities = 19/64 (29%), Positives = 32/64 (50%) Frame = -2 Query: 553 GEVMSTQQKCPLPDKNGWLVEEVMTLEAPYSIPVGAEFVQAEVMQCPSIYWHGMAKELQE 374 G ++ Q+ LPD+ + E V + +PVGA VQ EV G +E++E Sbjct: 13 GRALAAPQQEALPDETEVVEETVAEVAEVAEVPVGANPVQVEV---------GEFEEVEE 63 Query: 373 SKED 362 ++E+ Sbjct: 64 TEEE 67 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 101,207,833 Number of Sequences: 219361 Number of extensions: 2235712 Number of successful extensions: 5933 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 5668 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5933 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 5938641176 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)