Clone Name | rbasd26m17 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | COX20_YEAST (Q04935) Cytochrome c oxidase protein 20, mitochondr... | 29 | 9.3 |
---|
>COX20_YEAST (Q04935) Cytochrome c oxidase protein 20, mitochondrial precursor| Length = 205 Score = 29.3 bits (64), Expect = 9.3 Identities = 15/37 (40%), Positives = 18/37 (48%) Frame = -2 Query: 545 DSSIQVQPLGKVDGYRAVFRKEANVKTISKDEYPKFA 435 D Q QP GK DG R + K + +D PKFA Sbjct: 12 DQKQQQQPQGKADGDRVLTNYSRGQKILLEDTPPKFA 48 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 88,802,164 Number of Sequences: 219361 Number of extensions: 1825764 Number of successful extensions: 3844 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 3754 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3844 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 5367617986 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)