Clone Name | rbasd26k11 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | YMM1_CAEEL (P34489) Hypothetical protein K01B6.1 | 31 | 2.8 | 2 | ATS5_MOUSE (Q9R001) ADAMTS-5 precursor (EC 3.4.24.-) (A disinteg... | 30 | 4.8 | 3 | DGOT_ECOLI (P0AA76) D-galactonate transporter | 30 | 6.3 | 4 | DGOT_ECOL6 (P0AA77) D-galactonate transporter | 30 | 6.3 | 5 | TIMD4_HUMAN (Q96H15) T-cell immunoglobulin and mucin domain-cont... | 29 | 8.2 |
---|
>YMM1_CAEEL (P34489) Hypothetical protein K01B6.1| Length = 732 Score = 30.8 bits (68), Expect = 2.8 Identities = 21/81 (25%), Positives = 30/81 (37%) Frame = +3 Query: 171 YQTELQHCHTCHATSHSWSNPCTLK*LAYCFA*NPLQI*RRNSYLASDMRDCLLCSFVAT 350 Y Q+C C HS PC + R ++A M C C F +T Sbjct: 144 YPCTFQYCVICQKDVHSSKLPCHI----------------RQCHVAKPMFQCPACDFTST 187 Query: 351 FRNDVXEVTSPHYSVSSIAGD 413 + + V S S+ +AGD Sbjct: 188 YSKN--NVKSHMVSLHGLAGD 206
>ATS5_MOUSE (Q9R001) ADAMTS-5 precursor (EC 3.4.24.-) (A disintegrin and| metalloproteinase with thrombospondin motifs 5) (ADAM-TS 5) (ADAM-TS5) (Aggrecanase-2) (ADMP-2) (Implantin) Length = 930 Score = 30.0 bits (66), Expect = 4.8 Identities = 17/59 (28%), Positives = 27/59 (45%), Gaps = 2/59 (3%) Frame = -1 Query: 380 GSDFPYVVPECGYKGAKEAISHVAGKVAVSSSDLEWILGK--TVSQLFQGAWVTP*VRC 210 G + + VP+ + ISH + KV S+ L+W+ G S+ W T V+C Sbjct: 844 GVRYSFFVPKKTTQKVNSVISHGSNKVGPHSTQLQWVTGPWLACSRTCDTGWHTRTVQC 902
>DGOT_ECOLI (P0AA76) D-galactonate transporter| Length = 430 Score = 29.6 bits (65), Expect = 6.3 Identities = 14/42 (33%), Positives = 21/42 (50%) Frame = -3 Query: 540 KGIXFIXEXSQIPTGLRQIQXSFPDHQRSVSV*GHVSASFSG 415 + I I E PT R + FP+H+R+ +V + S F G Sbjct: 111 RAITGIFEAPAFPTNNRMVTSWFPEHERASAVGFYTSGQFVG 152
>DGOT_ECOL6 (P0AA77) D-galactonate transporter| Length = 430 Score = 29.6 bits (65), Expect = 6.3 Identities = 14/42 (33%), Positives = 21/42 (50%) Frame = -3 Query: 540 KGIXFIXEXSQIPTGLRQIQXSFPDHQRSVSV*GHVSASFSG 415 + I I E PT R + FP+H+R+ +V + S F G Sbjct: 111 RAITGIFEAPAFPTNNRMVTSWFPEHERASAVGFYTSGQFVG 152
>TIMD4_HUMAN (Q96H15) T-cell immunoglobulin and mucin domain-containing protein| 4 precursor (TIMD-4) (T-cell membrane protein 4) (TIM-4) Length = 378 Score = 29.3 bits (64), Expect = 8.2 Identities = 15/51 (29%), Positives = 23/51 (45%) Frame = -1 Query: 407 SYGANRIMWGSDFPYVVPECGYKGAKEAISHVAGKVAVSSSDLEWILGKTV 255 S+ +N + WG D +C Y G KEA+ G S ++ L T+ Sbjct: 46 SHNSNSMCWGKD------QCPYSGCKEALIRTDGMRVTSRKSAKYRLQGTI 90 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 76,426,364 Number of Sequences: 219361 Number of extensions: 1496946 Number of successful extensions: 3388 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 3309 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3388 length of database: 80,573,946 effective HSP length: 106 effective length of database: 57,321,680 effective search space used: 4757699440 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)