Clone Name | rbasd26j21 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | LAMC1_HUMAN (P11047) Laminin gamma-1 chain precursor (Laminin B2... | 28 | 4.9 | 2 | NPD2_BRAJA (Q89EA6) NAD-dependent deacetylase 2 (EC 3.5.1.-) (Re... | 28 | 8.4 | 3 | LAMB2_HUMAN (P55268) Laminin beta-2 chain precursor (S-laminin) ... | 28 | 8.4 |
---|
>LAMC1_HUMAN (P11047) Laminin gamma-1 chain precursor (Laminin B2 chain)| Length = 1609 Score = 28.5 bits (62), Expect = 4.9 Identities = 10/19 (52%), Positives = 12/19 (63%) Frame = -1 Query: 156 CEHCYVDYLGFD*TGCKAC 100 CE C V++ GF GCK C Sbjct: 965 CERCEVNHFGFGPEGCKPC 983
>NPD2_BRAJA (Q89EA6) NAD-dependent deacetylase 2 (EC 3.5.1.-) (Regulatory| protein SIR2 homolog 2) Length = 273 Score = 27.7 bits (60), Expect = 8.4 Identities = 14/42 (33%), Positives = 21/42 (50%) Frame = -1 Query: 144 YVDYLGFD*TGCKACKWILRFIVLYFVTAIDIQVVCNHGDHL 19 + D+ F C+AC IL+ V++F + VV DHL Sbjct: 170 HADFSSFKVPACEACGGILKPDVVFFGENVPRDVVATAQDHL 211
>LAMB2_HUMAN (P55268) Laminin beta-2 chain precursor (S-laminin) (Laminin B1s| chain) Length = 1798 Score = 27.7 bits (60), Expect = 8.4 Identities = 10/20 (50%), Positives = 13/20 (65%) Frame = -1 Query: 156 CEHCYVDYLGFD*TGCKACK 97 C+ C Y GF TGC+AC+ Sbjct: 813 CDLCAPGYYGFGPTGCQACQ 832 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 23,156,171 Number of Sequences: 219361 Number of extensions: 315514 Number of successful extensions: 576 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 573 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 576 length of database: 80,573,946 effective HSP length: 50 effective length of database: 69,605,896 effective search space used: 1670541504 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)