Clone Name | rbasd26h14 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | AERA_AERSO (Q06304) Aerolysin precursor (Hemolysin) | 29 | 7.8 | 2 | AERA_AERSA (Q08676) Aerolysin precursor (Hemolysin-3) | 29 | 7.8 |
---|
>AERA_AERSO (Q06304) Aerolysin precursor (Hemolysin)| Length = 488 Score = 28.9 bits (63), Expect = 7.8 Identities = 22/64 (34%), Positives = 27/64 (42%), Gaps = 1/64 (1%) Frame = +3 Query: 144 YMVFPGFYIEHKTGIHQXRNNHSIFPRCNSDYDVADQFTLFVDSHRVL-NNNGYILGLRC 320 Y + P Y+ H G NHS P D DV T D + NN+G G RC Sbjct: 135 YFIKPVSYLAHYLGYAWVGGNHS--PYVGEDMDV----TRVGDGWLIKGNNDGGCSGYRC 188 Query: 321 GNRS 332 G +S Sbjct: 189 GEKS 192
>AERA_AERSA (Q08676) Aerolysin precursor (Hemolysin-3)| Length = 489 Score = 28.9 bits (63), Expect = 7.8 Identities = 22/64 (34%), Positives = 27/64 (42%), Gaps = 1/64 (1%) Frame = +3 Query: 144 YMVFPGFYIEHKTGIHQXRNNHSIFPRCNSDYDVADQFTLFVDSHRVL-NNNGYILGLRC 320 Y + P Y+ H G NHS P D DV T D + NN+G G RC Sbjct: 136 YFIKPVSYLAHYLGYAWVGGNHS--PYVGEDMDV----TRVGDGWLIKGNNDGGCSGYRC 189 Query: 321 GNRS 332 G +S Sbjct: 190 GEKS 193 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 75,894,844 Number of Sequences: 219361 Number of extensions: 1586534 Number of successful extensions: 3909 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3718 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3909 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3478785780 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)