Clone Name | rbasd26g05 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | SYI_METAC (Q8TN62) Isoleucyl-tRNA synthetase (EC 6.1.1.5) (Isole... | 30 | 2.3 | 2 | SYI_METMA (Q8PSV9) Isoleucyl-tRNA synthetase (EC 6.1.1.5) (Isole... | 29 | 4.0 |
---|
>SYI_METAC (Q8TN62) Isoleucyl-tRNA synthetase (EC 6.1.1.5) (Isoleucine--tRNA| ligase) (IleRS) Length = 1058 Score = 29.6 bits (65), Expect = 2.3 Identities = 13/42 (30%), Positives = 24/42 (57%) Frame = +2 Query: 41 SKHQMVYKTIRSMITGWLVHKR*RVIMSMCINKLSTFFLMEI 166 S+ Q V K + ++G+L+HK R I+ + LS +++ I Sbjct: 689 SRAQSVIKAVNEAMSGYLLHKAVREILEFALEDLSRWYIQLI 730
>SYI_METMA (Q8PSV9) Isoleucyl-tRNA synthetase (EC 6.1.1.5) (Isoleucine--tRNA| ligase) (IleRS) Length = 1058 Score = 28.9 bits (63), Expect = 4.0 Identities = 13/42 (30%), Positives = 25/42 (59%) Frame = +2 Query: 41 SKHQMVYKTIRSMITGWLVHKR*RVIMSMCINKLSTFFLMEI 166 S+ Q V K++ ++G+L+HK R I+ + LS +++ I Sbjct: 689 SRAQSVVKSVDEAMSGYLLHKAVREILDFTLEDLSRWYIQLI 730 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 24,698,605 Number of Sequences: 219361 Number of extensions: 347396 Number of successful extensions: 804 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 801 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 804 length of database: 80,573,946 effective HSP length: 32 effective length of database: 73,554,394 effective search space used: 1765305456 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)