Clone Name | rbasd26g04 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | ENGB_BRUSU (P64067) Probable GTP-binding protein engB | 31 | 2.2 | 2 | ENGB_BRUME (P64066) Probable GTP-binding protein engB | 31 | 2.2 | 3 | ILVD1_BRAJA (Q89LK8) Dihydroxy-acid dehydratase 1 (EC 4.2.1.9) (... | 29 | 8.5 | 4 | ILVD_XYLFT (Q87F63) Dihydroxy-acid dehydratase (EC 4.2.1.9) (DAD) | 29 | 8.5 | 5 | ILVD_XYLFA (Q9PH47) Dihydroxy-acid dehydratase (EC 4.2.1.9) (DAD) | 29 | 8.5 | 6 | HAIR_MOUSE (Q61645) Protein hairless | 29 | 8.5 |
---|
>ENGB_BRUSU (P64067) Probable GTP-binding protein engB| Length = 241 Score = 31.2 bits (69), Expect = 2.2 Identities = 18/36 (50%), Positives = 23/36 (63%), Gaps = 1/36 (2%) Frame = +3 Query: 75 KLDQID-SHQPRLLMEFHKLAYKSARIYAPIISLSS 179 K+D+I + PRLL E HKL YK A + II+ SS Sbjct: 186 KIDKIKPAGVPRLLEETHKLTYKRAACFPGIIATSS 221
>ENGB_BRUME (P64066) Probable GTP-binding protein engB| Length = 241 Score = 31.2 bits (69), Expect = 2.2 Identities = 18/36 (50%), Positives = 23/36 (63%), Gaps = 1/36 (2%) Frame = +3 Query: 75 KLDQID-SHQPRLLMEFHKLAYKSARIYAPIISLSS 179 K+D+I + PRLL E HKL YK A + II+ SS Sbjct: 186 KIDKIKPAGVPRLLEETHKLTYKRAACFPGIIATSS 221
>ILVD1_BRAJA (Q89LK8) Dihydroxy-acid dehydratase 1 (EC 4.2.1.9) (DAD 1)| Length = 616 Score = 29.3 bits (64), Expect = 8.5 Identities = 18/51 (35%), Positives = 30/51 (58%), Gaps = 2/51 (3%) Frame = +1 Query: 238 LYSLPF*E--ADIHPWKAKAHQISYYILCVVSKDMSRPNLISTSLRIHLPA 384 LYSLP E AD + A AH + ++C+ + D P ++ +LR+++PA Sbjct: 91 LYSLPSRELIADSVEYMANAH-CADGLVCISNCDKITPGMLMAALRLNIPA 140
>ILVD_XYLFT (Q87F63) Dihydroxy-acid dehydratase (EC 4.2.1.9) (DAD)| Length = 610 Score = 29.3 bits (64), Expect = 8.5 Identities = 18/50 (36%), Positives = 29/50 (58%), Gaps = 2/50 (4%) Frame = +1 Query: 238 LYSLPF*E--ADIHPWKAKAHQISYYILCVVSKDMSRPNLISTSLRIHLP 381 LYSLP E AD + A AH + ++C+ + D P ++ SLR+++P Sbjct: 91 LYSLPSREIIADSVEYMANAH-CADALVCISNCDKITPGMLMASLRLNIP 139
>ILVD_XYLFA (Q9PH47) Dihydroxy-acid dehydratase (EC 4.2.1.9) (DAD)| Length = 610 Score = 29.3 bits (64), Expect = 8.5 Identities = 18/50 (36%), Positives = 29/50 (58%), Gaps = 2/50 (4%) Frame = +1 Query: 238 LYSLPF*E--ADIHPWKAKAHQISYYILCVVSKDMSRPNLISTSLRIHLP 381 LYSLP E AD + A AH + ++C+ + D P ++ SLR+++P Sbjct: 91 LYSLPSREIIADSVEYMANAH-CADALVCISNCDKITPGMLMASLRLNIP 139
>HAIR_MOUSE (Q61645) Protein hairless| Length = 1182 Score = 29.3 bits (64), Expect = 8.5 Identities = 12/26 (46%), Positives = 16/26 (61%) Frame = +2 Query: 467 PLASQTMLGIASGGSIKQGTEKRSPN 544 PLA MLG+A GG ++Q E P+ Sbjct: 220 PLAESGMLGLAPGGHLQQACESEGPS 245 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 82,726,792 Number of Sequences: 219361 Number of extensions: 1655620 Number of successful extensions: 3642 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 3514 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3642 length of database: 80,573,946 effective HSP length: 106 effective length of database: 57,321,680 effective search space used: 4929664480 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)