Clone Name | rbasd26f12 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | PE2R4_HUMAN (P35408) Prostaglandin E2 receptor, EP4 subtype (Pro... | 28 | 4.9 | 2 | PE2R4_PANTR (Q95KZ0) Prostaglandin E2 receptor, EP4 subtype (Pro... | 28 | 6.4 | 3 | IDLC_STRPU (Q26630) 33 kDa inner dynein arm light chain, axonema... | 28 | 8.4 | 4 | PE2R4_RABIT (Q28691) Prostaglandin E2 receptor, EP4 subtype (Pro... | 28 | 8.4 |
---|
>PE2R4_HUMAN (P35408) Prostaglandin E2 receptor, EP4 subtype (Prostanoid EP4| receptor) (PGE receptor, EP4 subtype) Length = 488 Score = 28.5 bits (62), Expect = 4.9 Identities = 16/34 (47%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Frame = -3 Query: 104 SAC*LAMRSHPSAASFLEGLSPFRRRK-FEAITG 6 +A +A R HP+A+ L LS FRRR+ F I G Sbjct: 232 AAASVASRGHPAASPALPRLSDFRRRRSFRRIAG 265
>PE2R4_PANTR (Q95KZ0) Prostaglandin E2 receptor, EP4 subtype (Prostanoid EP4| receptor) (PGE receptor, EP4 subtype) Length = 490 Score = 28.1 bits (61), Expect = 6.4 Identities = 15/30 (50%), Positives = 19/30 (63%), Gaps = 1/30 (3%) Frame = -3 Query: 92 LAMRSHPSAASFLEGLSPFRRRK-FEAITG 6 +A R HP+A+ L LS FRRR+ F I G Sbjct: 238 VASRGHPAASPALPRLSDFRRRRSFRRIAG 267
>IDLC_STRPU (Q26630) 33 kDa inner dynein arm light chain, axonemal (p33)| Length = 260 Score = 27.7 bits (60), Expect = 8.4 Identities = 14/34 (41%), Positives = 18/34 (52%), Gaps = 6/34 (17%) Frame = +2 Query: 143 PPTKNGHAPPPIESRKSSQ------SVNPCYVWT 226 PP K G PP+ES+K+ Q S+ P WT Sbjct: 47 PPPKGGSKLPPVESQKAQQTDEILNSILPPREWT 80
>PE2R4_RABIT (Q28691) Prostaglandin E2 receptor, EP4 subtype (Prostanoid EP4| receptor) (PGE receptor, subtype EP4) Length = 488 Score = 27.7 bits (60), Expect = 8.4 Identities = 15/29 (51%), Positives = 18/29 (62%), Gaps = 1/29 (3%) Frame = -3 Query: 89 AMRSHPSAASFLEGLSPFRRRK-FEAITG 6 A R HP+A+ L LS FRRR+ F I G Sbjct: 240 ACRGHPTASPALPRLSDFRRRRSFRRIAG 268 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 30,860,316 Number of Sequences: 219361 Number of extensions: 462079 Number of successful extensions: 1065 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1038 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1065 length of database: 80,573,946 effective HSP length: 50 effective length of database: 69,605,896 effective search space used: 1670541504 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)