Clone Name | rbasd25p16 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | PHO85_KLULA (Q92241) Negative regulator of the PHO system (EC 2.... | 30 | 1.5 | 2 | PACC_MAGGR (Q52B93) pH-response transcription factor pacC/RIM101 | 28 | 4.5 | 3 | ZBT39_HUMAN (O15060) Zinc finger and BTB domain-containing prote... | 28 | 5.9 |
---|
>PHO85_KLULA (Q92241) Negative regulator of the PHO system (EC 2.7.11.22)| (Serine/threonine-protein kinase PHO85) Length = 304 Score = 30.0 bits (66), Expect = 1.5 Identities = 15/42 (35%), Positives = 19/42 (45%) Frame = +3 Query: 54 TTCHARWNQPTALIIYTHILGKHKPRESRNSCQRNSEHSDDD 179 T W Q T L Y +L H PR+ + Q N+E DD Sbjct: 227 TPVEQTWPQVTQLAKYNPLLPPHMPRDLKQLLQNNTEEVLDD 268
>PACC_MAGGR (Q52B93) pH-response transcription factor pacC/RIM101| Length = 559 Score = 28.5 bits (62), Expect = 4.5 Identities = 17/47 (36%), Positives = 24/47 (51%), Gaps = 9/47 (19%) Frame = +3 Query: 48 TDTTCHARWNQ-----PTALIIYTHILGKHKPRESRN----SCQRNS 161 +D + RWNQ P+A +Y HI +H R+S N +C NS Sbjct: 48 SDDSLICRWNQCSERFPSAEALYDHICERHVGRKSTNNLNLTCHWNS 94
>ZBT39_HUMAN (O15060) Zinc finger and BTB domain-containing protein 39| Length = 712 Score = 28.1 bits (61), Expect = 5.9 Identities = 14/25 (56%), Positives = 17/25 (68%) Frame = +3 Query: 141 NSCQRNSEHSDDDVIHFGQVESLRL 215 NSC NSEHS D FGQ++ L+L Sbjct: 274 NSCLSNSEHSKDP--GFGQMDELQL 296 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 41,712,260 Number of Sequences: 219361 Number of extensions: 740244 Number of successful extensions: 1699 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1684 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1699 length of database: 80,573,946 effective HSP length: 78 effective length of database: 63,463,788 effective search space used: 1523130912 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)