| Clone Name | rbasd25p10 |
|---|---|
| Clone Library Name | barley_pub |
>NLT43_HORVU (Q42842) Nonspecific lipid-transfer protein 4.3 precursor (LTP 4.3)| Length = 115 Score = 40.0 bits (92), Expect = 0.002 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = -1 Query: 293 MCGVSVPYAISASVXCXKIR 234 MCGVSVPYAISASV C KIR Sbjct: 96 MCGVSVPYAISASVDCSKIR 115
>NLT42_HORVU (Q43875) Nonspecific lipid-transfer protein 4.2 precursor (LTP 4.2)| (Low-temperature-responsive protein 4.9) Length = 115 Score = 40.0 bits (92), Expect = 0.002 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = -1 Query: 293 MCGVSVPYAISASVXCXKIR 234 MCGVSVPYAISASV C KIR Sbjct: 96 MCGVSVPYAISASVDCSKIR 115
>NLT41_HORVU (Q43767) Nonspecific lipid-transfer protein 4.1 precursor (LTP 4.1)| (CW21) (CW-21) Length = 115 Score = 40.0 bits (92), Expect = 0.002 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = -1 Query: 293 MCGVSVPYAISASVXCXKIR 234 MCGVSVPYAISASV C KIR Sbjct: 96 MCGVSVPYAISASVDCSKIR 115
>NLTP8_HORVU (Q43871) Nonspecific lipid-transfer protein Cw18 precursor (LTP| Cw-18) (PKG2316) Length = 115 Score = 34.7 bits (78), Expect = 0.064 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = -1 Query: 290 CGVSVPYAISASVXCXKI 237 CGVSVPY ISASV C KI Sbjct: 97 CGVSVPYTISASVDCSKI 114
>NLTP1_ORYSA (P23096) Nonspecific lipid-transfer protein 1 precursor (LTP 1)| (PAPI) Length = 116 Score = 32.7 bits (73), Expect = 0.24 Identities = 12/18 (66%), Positives = 15/18 (83%) Frame = -1 Query: 290 CGVSVPYAISASVXCXKI 237 CGVSVPY ISAS+ C ++ Sbjct: 98 CGVSVPYTISASIDCSRV 115
>NLTP_ELECO (P23802) Nonspecific lipid-transfer protein (LTP) (Alpha-amylase| inhibitor I-2) Length = 95 Score = 31.2 bits (69), Expect = 0.70 Identities = 11/18 (61%), Positives = 15/18 (83%) Frame = -1 Query: 290 CGVSVPYAISASVXCXKI 237 CGV +PYAISAS+ C ++ Sbjct: 76 CGVRLPYAISASIDCSRV 93
>NLTP_HELAN (Q39950) Nonspecific lipid-transfer protein precursor (LTP) (NsLTP)| (SDI-9) Length = 116 Score = 30.4 bits (67), Expect = 1.2 Identities = 11/19 (57%), Positives = 14/19 (73%) Frame = -1 Query: 290 CGVSVPYAISASVXCXKIR 234 CGVS+PY IS S C K++ Sbjct: 98 CGVSIPYKISPSTDCSKVQ 116
>NLTP3_ORYSA (Q42999) Nonspecific lipid-transfer protein 3 precursor (LTP 3)| Length = 117 Score = 30.4 bits (67), Expect = 1.2 Identities = 10/18 (55%), Positives = 14/18 (77%) Frame = -1 Query: 290 CGVSVPYAISASVXCXKI 237 CGVS+PY IS S+ C ++ Sbjct: 99 CGVSIPYTISPSIDCSRV 116
>NLTP1_SORBI (Q43193) Nonspecific lipid-transfer protein 1 precursor (LTP 1)| Length = 118 Score = 30.0 bits (66), Expect = 1.6 Identities = 11/18 (61%), Positives = 13/18 (72%) Frame = -1 Query: 290 CGVSVPYAISASVXCXKI 237 CGVSVPY IS S C ++ Sbjct: 100 CGVSVPYTISTSTDCSRV 117
>NLTP5_ORYSA (O65091) Nonspecific lipid-transfer protein 5 precursor (LTP 5)| Length = 117 Score = 29.6 bits (65), Expect = 2.0 Identities = 10/18 (55%), Positives = 14/18 (77%) Frame = -1 Query: 290 CGVSVPYAISASVXCXKI 237 CGV++PYAIS S C ++ Sbjct: 99 CGVNIPYAISPSTDCSRV 116
>NLTP2_SORBI (Q43194) Nonspecific lipid-transfer protein 2 precursor (LTP 2)| Length = 122 Score = 29.6 bits (65), Expect = 2.0 Identities = 10/18 (55%), Positives = 13/18 (72%) Frame = -1 Query: 290 CGVSVPYAISASVXCXKI 237 CGVS+PY IS S C ++ Sbjct: 104 CGVSIPYTISTSTDCSRV 121
>NLTP1_PRUDO (P82534) Nonspecific lipid-transfer protein 1 (LTP 1) (Major| allergen Pru d 3) Length = 91 Score = 29.6 bits (65), Expect = 2.0 Identities = 11/19 (57%), Positives = 14/19 (73%) Frame = -1 Query: 290 CGVSVPYAISASVXCXKIR 234 CGV+VPY ISAS C ++ Sbjct: 73 CGVNVPYKISASTNCATVK 91
>NLTP_MAIZE (P19656) Nonspecific lipid-transfer protein precursor (LTP)| (Phospholipid transfer protein) (PLTP) (Allergen Zea m 14) Length = 120 Score = 29.6 bits (65), Expect = 2.0 Identities = 10/18 (55%), Positives = 13/18 (72%) Frame = -1 Query: 290 CGVSVPYAISASVXCXKI 237 CGVS+PY IS S C ++ Sbjct: 102 CGVSIPYTISTSTDCSRV 119
>ATP7A_CRIGR (P49015) Copper-transporting ATPase 1 (EC 3.6.3.4) (Copper pump 1)| (Fragment) Length = 1476 Score = 29.6 bits (65), Expect = 2.0 Identities = 14/40 (35%), Positives = 22/40 (55%) Frame = -1 Query: 176 HXHTYI*INALILSSCGIYIERDREREDGVSMLSQFCMAG 57 H YI ++ + +SC IER+ RE+G+ + MAG Sbjct: 477 HSKCYIQVSGMTCASCVANIERNLRREEGIYSVLVALMAG 516
>NLTP_SPIOL (P10976) Nonspecific lipid-transfer protein precursor (LTP)| (Phospholipid transfer protein) (PLTP) Length = 117 Score = 29.3 bits (64), Expect = 2.7 Identities = 11/19 (57%), Positives = 13/19 (68%) Frame = -1 Query: 293 MCGVSVPYAISASVXCXKI 237 MCGV +PYAIS S C + Sbjct: 98 MCGVHIPYAISPSTNCNAV 116
>NLTP4_ARATH (Q9LLR6) Nonspecific lipid-transfer protein 4 precursor (LTP 4)| Length = 112 Score = 29.3 bits (64), Expect = 2.7 Identities = 11/19 (57%), Positives = 13/19 (68%) Frame = -1 Query: 290 CGVSVPYAISASVXCXKIR 234 CGVS+PY IS S C I+ Sbjct: 94 CGVSIPYPISTSTNCATIK 112
>NLTP1_PRUAR (P81651) Nonspecific lipid-transfer protein 1 (LTP 1) (Major| allergen Pru ar 3) Length = 91 Score = 29.3 bits (64), Expect = 2.7 Identities = 10/19 (52%), Positives = 14/19 (73%) Frame = -1 Query: 290 CGVSVPYAISASVXCXKIR 234 CGV++PY ISAS C ++ Sbjct: 73 CGVNIPYKISASTNCATVK 91
>NLTP2_TOBAC (Q03461) Nonspecific lipid-transfer protein 2 precursor (LTP 2)| Length = 114 Score = 29.3 bits (64), Expect = 2.7 Identities = 10/19 (52%), Positives = 14/19 (73%) Frame = -1 Query: 290 CGVSVPYAISASVXCXKIR 234 CGV++PY IS S C K++ Sbjct: 96 CGVNIPYKISPSTDCSKVQ 114
>NLTP1_TOBAC (Q42952) Nonspecific lipid-transfer protein 1 precursor (LTP 1)| (Pathogenesis-related protein 14) (PR-14) Length = 114 Score = 29.3 bits (64), Expect = 2.7 Identities = 10/19 (52%), Positives = 14/19 (73%) Frame = -1 Query: 290 CGVSVPYAISASVXCXKIR 234 CGV++PY IS S C K++ Sbjct: 96 CGVNIPYKISPSTDCSKVQ 114
>NLTP_BETVU (Q43748) Nonspecific lipid-transfer protein precursor (LTP)| Length = 117 Score = 28.9 bits (63), Expect = 3.5 Identities = 12/18 (66%), Positives = 13/18 (72%) Frame = -1 Query: 290 CGVSVPYAISASVXCXKI 237 CGVSVPYAIS + C I Sbjct: 99 CGVSVPYAISPNTNCNAI 116
>NLTP3_ARATH (Q9LLR7) Nonspecific lipid-transfer protein 3 precursor (LTP 3)| Length = 115 Score = 28.9 bits (63), Expect = 3.5 Identities = 11/19 (57%), Positives = 13/19 (68%) Frame = -1 Query: 290 CGVSVPYAISASVXCXKIR 234 CGVS+PY IS S C I+ Sbjct: 97 CGVSIPYPISMSTNCNNIK 115
>NLTPB_BRAOT (Q42642) Nonspecific lipid-transfer protein B precursor (LTP B)| (Wax-associated protein 9B) Length = 117 Score = 28.5 bits (62), Expect = 4.6 Identities = 10/19 (52%), Positives = 13/19 (68%) Frame = -1 Query: 290 CGVSVPYAISASVXCXKIR 234 CGV++PY IS S C +R Sbjct: 99 CGVNIPYKISKSTNCNSVR 117
>NLTP2_BRANA (Q42615) Nonspecific lipid-transfer protein 2 precursor (LTP 2)| Length = 117 Score = 28.5 bits (62), Expect = 4.6 Identities = 10/19 (52%), Positives = 13/19 (68%) Frame = -1 Query: 290 CGVSVPYAISASVXCXKIR 234 CGV++PY IS S C +R Sbjct: 99 CGVNIPYKISKSTNCNSVR 117
>NLTP1_BRANA (Q42614) Nonspecific lipid-transfer protein 1 precursor (LTP 1)| Length = 117 Score = 28.5 bits (62), Expect = 4.6 Identities = 10/19 (52%), Positives = 13/19 (68%) Frame = -1 Query: 290 CGVSVPYAISASVXCXKIR 234 CGV++PY IS S C +R Sbjct: 99 CGVNIPYKISKSTNCNSVR 117
>NLTP1_PRUPE (P81402) Nonspecific lipid-transfer protein 1 (LTP 1) (Major| allergen Pru p 3) (Pru p 1) Length = 91 Score = 28.5 bits (62), Expect = 4.6 Identities = 10/19 (52%), Positives = 13/19 (68%) Frame = -1 Query: 290 CGVSVPYAISASVXCXKIR 234 CGV +PY ISAS C ++ Sbjct: 73 CGVHIPYKISASTNCATVK 91
>GPMI_METMA (Q8PYF8) 2,3-bisphosphoglycerate-independent phosphoglycerate| mutase (EC 5.4.2.1) (Phosphoglyceromutase) (BPG-independent PGAM) (iPGM) Length = 521 Score = 28.5 bits (62), Expect = 4.6 Identities = 14/41 (34%), Positives = 21/41 (51%) Frame = +1 Query: 142 MRAFIHIYVXXCDLNVLXVDCWGYRQQVVDQRILXXSTEAL 264 MR +H+ L ++ +D WGYR++ IL ST L Sbjct: 1 MRISLHMTQARRPLMLMILDGWGYREEKEGNAILAASTPHL 41
>NLTP3_HORVU (Q43766) Nonspecific lipid-transfer protein 3 precursor (LTP 3)| (CW20) (CW-20) (CW-19) Length = 118 Score = 28.5 bits (62), Expect = 4.6 Identities = 11/18 (61%), Positives = 13/18 (72%) Frame = -1 Query: 290 CGVSVPYAISASVXCXKI 237 CGVSVP+ IS S C K+ Sbjct: 100 CGVSVPFPISMSTDCNKV 117
>NLTP2_ORYSA (Q42978) Nonspecific lipid-transfer protein 2 precursor (LTP 2)| Length = 118 Score = 28.5 bits (62), Expect = 4.6 Identities = 9/18 (50%), Positives = 13/18 (72%) Frame = -1 Query: 290 CGVSVPYAISASVXCXKI 237 CGV++PY IS S+ C + Sbjct: 100 CGVTIPYTISPSIDCSSV 117
>NLTP1_ARATH (Q42589) Nonspecific lipid-transfer protein 1 precursor (LTP 1)| Length = 118 Score = 28.5 bits (62), Expect = 4.6 Identities = 10/19 (52%), Positives = 13/19 (68%) Frame = -1 Query: 290 CGVSVPYAISASVXCXKIR 234 CGV++PY IS S C +R Sbjct: 100 CGVNIPYKISTSTNCKTVR 118
>NLTP_PYRCO (Q9M5X6) Nonspecific lipid-transfer protein precursor (LTP)| (Allergen Pyr c 3) Length = 115 Score = 28.1 bits (61), Expect = 6.0 Identities = 10/19 (52%), Positives = 13/19 (68%) Frame = -1 Query: 290 CGVSVPYAISASVXCXKIR 234 CGV+VPY IS S C ++ Sbjct: 97 CGVNVPYKISTSTNCATVK 115
>NLTP_MALDO (Q9M5X7) Nonspecific lipid-transfer protein precursor (LTP)| (Allergen Mal d 3) Length = 115 Score = 28.1 bits (61), Expect = 6.0 Identities = 10/19 (52%), Positives = 13/19 (68%) Frame = -1 Query: 290 CGVSVPYAISASVXCXKIR 234 CGV+VPY IS S C ++ Sbjct: 97 CGVNVPYKISTSTNCATVK 115
>NLTP4_ORYSA (Q42976) Nonspecific lipid-transfer protein 4 precursor (LTP 4)| Length = 121 Score = 28.1 bits (61), Expect = 6.0 Identities = 12/18 (66%), Positives = 13/18 (72%) Frame = -1 Query: 290 CGVSVPYAISASVXCXKI 237 CGVSV + IS SV C KI Sbjct: 103 CGVSVAFPISTSVDCSKI 120
>PME17_BOVIN (Q06154) Melanocyte protein Pmel 17 (Retinal pigment| epithelial-specific protein) (Fragment) Length = 491 Score = 27.7 bits (60), Expect = 7.8 Identities = 12/41 (29%), Positives = 21/41 (51%) Frame = -3 Query: 123 IYRERQRERGRSIYVEPVLHGRPYCSIHVWLFLHCXLGDPR 1 IYR R ++G + + + HGR W+F C +G+ + Sbjct: 443 IYRRRLMKQGSEVPLPQLPHGRTQWLRLPWVFRSCPIGESK 483
>SYI_YERPS (Q66ES4) Isoleucyl-tRNA synthetase (EC 6.1.1.5) (Isoleucine--tRNA| ligase) (IleRS) Length = 938 Score = 27.7 bits (60), Expect = 7.8 Identities = 12/29 (41%), Positives = 17/29 (58%) Frame = -3 Query: 126 DIYRERQRERGRSIYVEPVLHGRPYCSIH 40 D+ E RE+G ++VE +LH P C H Sbjct: 381 DVVVELLREKGALLHVEKLLHSYPCCWRH 409
>SYI_YERPE (Q8ZIM0) Isoleucyl-tRNA synthetase (EC 6.1.1.5) (Isoleucine--tRNA| ligase) (IleRS) Length = 938 Score = 27.7 bits (60), Expect = 7.8 Identities = 12/29 (41%), Positives = 17/29 (58%) Frame = -3 Query: 126 DIYRERQRERGRSIYVEPVLHGRPYCSIH 40 D+ E RE+G ++VE +LH P C H Sbjct: 381 DVVVELLREKGALLHVEKLLHSYPCCWRH 409
>NLTP_PRUAV (Q9M5X8) Nonspecific lipid-transfer protein precursor (LTP)| (Allergen Pru av 3) Length = 117 Score = 27.7 bits (60), Expect = 7.8 Identities = 10/19 (52%), Positives = 13/19 (68%) Frame = -1 Query: 290 CGVSVPYAISASVXCXKIR 234 CGV+VPY IS S C ++ Sbjct: 99 CGVNVPYKISPSTNCATVK 117
>NLTP3_PRUDU (Q43019) Nonspecific lipid-transfer protein 3 precursor (LTP 3)| Length = 123 Score = 27.7 bits (60), Expect = 7.8 Identities = 10/19 (52%), Positives = 13/19 (68%) Frame = -1 Query: 290 CGVSVPYAISASVXCXKIR 234 CGV++PY IS S C I+ Sbjct: 105 CGVNIPYKISPSTDCKSIK 123
>NLTP1_PRUDU (Q43017) Nonspecific lipid-transfer protein 1 precursor (LTP 1)| Length = 117 Score = 27.7 bits (60), Expect = 7.8 Identities = 9/19 (47%), Positives = 13/19 (68%) Frame = -1 Query: 290 CGVSVPYAISASVXCXKIR 234 CGV++PY IS S C ++ Sbjct: 99 CGVNIPYQISPSTNCANVK 117 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 36,829,663 Number of Sequences: 219361 Number of extensions: 583502 Number of successful extensions: 1282 Number of sequences better than 10.0: 38 Number of HSP's better than 10.0 without gapping: 1276 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1282 length of database: 80,573,946 effective HSP length: 73 effective length of database: 64,560,593 effective search space used: 1549454232 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)