| Clone Name | rbasd26e01 |
|---|---|
| Clone Library Name | barley_pub |
>CTTB2_CALJA (Q2QLF8) Cortactin-binding protein 2 (CortBP2)| Length = 1662 Score = 29.3 bits (64), Expect = 2.5 Identities = 18/49 (36%), Positives = 25/49 (51%), Gaps = 2/49 (4%) Frame = -3 Query: 338 SVPSILPTPTIWWRLYGPASHAVPTPVSAIP--ANAGAPSTAATREFIP 198 SVP+ P+ GP++ + P P S+IP + APSTA T P Sbjct: 368 SVPAFPPSSANRIEENGPSTGSTPDPTSSIPPLPSNAAPSTAQTPGITP 416
>NDC1_PONPY (Q5RBY5) Nucleoporin NDC1 (Transmembrane protein 48)| Length = 674 Score = 28.9 bits (63), Expect = 3.2 Identities = 13/44 (29%), Positives = 22/44 (50%) Frame = +2 Query: 224 CWGRQHWPVWRILGWVRHARRGHITATIWWGWVVWRVLSTTMVV 355 C GR +WR+LGW I A+I W ++ + +T ++ Sbjct: 9 CAGRSRDILWRVLGW-------RIVASIIWSVLLLPICTTVFII 45
>NDC1_HUMAN (Q9BTX1) Nucleoporin NDC1 (hNDC1) (Transmembrane protein 48)| Length = 674 Score = 28.1 bits (61), Expect = 5.5 Identities = 13/44 (29%), Positives = 21/44 (47%) Frame = +2 Query: 224 CWGRQHWPVWRILGWVRHARRGHITATIWWGWVVWRVLSTTMVV 355 C GR +WR+LGW I A+I W + + +T ++ Sbjct: 9 CAGRSRDILWRVLGW-------RIVASIVWSVLFLPICTTVFII 45
>URE1_NOCFA (Q5YWR8) Urease alpha subunit (EC 3.5.1.5) (Urea amidohydrolase| alpha subunit) Length = 573 Score = 27.7 bits (60), Expect = 7.2 Identities = 15/42 (35%), Positives = 21/42 (50%), Gaps = 3/42 (7%) Frame = -3 Query: 329 SILPTPTIWWRLYGPASHAVPTPVSAIPA---NAGAPSTAAT 213 ++L I W G A+ ++PTP +P A AP AAT Sbjct: 452 AVLKGGAIAWAAMGDANASIPTPQPVLPRPMFGAAAPVAAAT 493
>GAL7_TRIRE (Q96UI1) Galactose-1-phosphate uridylyltransferase (EC 2.7.7.12)| (Gal-1-P uridylyltransferase) (UDP-glucose--hexose-1-phosphate uridylyltransferase) Length = 382 Score = 27.7 bits (60), Expect = 7.2 Identities = 17/38 (44%), Positives = 21/38 (55%), Gaps = 1/38 (2%) Frame = -3 Query: 338 SVPSILPTPTIWWRLYGPASHAVPT-PVSAIPANAGAP 228 S ILPT W RLY A+H P+ P+SA+ A P Sbjct: 129 SAKDILPTINHWTRLY--ANHLSPSNPLSAVAAQLQLP 164
>GGPPS_GIBFU (Q92236) Geranylgeranyl pyrophosphate synthetase (GGPP synthetase)| (GGPPSase) (Geranylgeranyl diphosphate synthase) [Includes: Dimethylallyltranstransferase (EC 2.5.1.1); Geranyltranstransferase (EC 2.5.1.10); Farnesyltranstransferase (EC 2.5 Length = 418 Score = 27.3 bits (59), Expect = 9.3 Identities = 14/32 (43%), Positives = 17/32 (53%) Frame = -2 Query: 105 AEDVGTTADDCKPLAGLPAFVFPICD*QLNLS 10 AE G + DC PL L +F I D +NLS Sbjct: 283 AEANGPSPTDCVPLVNLIGLIFQIRDDYMNLS 314 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 39,885,177 Number of Sequences: 219361 Number of extensions: 655052 Number of successful extensions: 2723 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 2646 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2722 length of database: 80,573,946 effective HSP length: 97 effective length of database: 59,295,929 effective search space used: 1423102296 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)