Clone Name | rbasd26b19 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | CLTR2_MOUSE (Q920A1) Cysteinyl leukotriene receptor 2 (CysLTR2) | 32 | 1.4 | 2 | TEGU_EBV (P03186) Large tegument protein | 30 | 8.8 |
---|
>CLTR2_MOUSE (Q920A1) Cysteinyl leukotriene receptor 2 (CysLTR2)| Length = 309 Score = 32.3 bits (72), Expect = 1.4 Identities = 26/85 (30%), Positives = 39/85 (45%) Frame = +3 Query: 15 SPCKXXNEIVVQHMRVN*CSYPLLFIFITDTYYSMNEINCHHTNNQMGPHNKHSISALNK 194 SP K + +++ H+ V + L F+ +T Y + I + GP H AL Sbjct: 175 SPQKFKSLLIMNHIAVA-VGFLLPFLTLTVCYLLIIRILLKAEIPESGPRAAHR-KALTT 232 Query: 195 C*ATMISSLLCSAPDHHLLPIYLVT 269 MI+ LLC P H L ++LVT Sbjct: 233 IVIAMITFLLCFLPYHALRTLHLVT 257
>TEGU_EBV (P03186) Large tegument protein| Length = 3149 Score = 29.6 bits (65), Expect = 8.8 Identities = 22/79 (27%), Positives = 35/79 (44%) Frame = +3 Query: 228 SAPDHHLLPIYLVTRVQSPVPQCHLQRPPAAPLEGRXXXXXXXXXXXXQPERTAASSLNP 407 ++P H P+ + +P P+ LQ P PL P TAA++ P Sbjct: 476 ASPTPHPAPVSTIAPSVTPSPRLPLQIP--IPLPQAAPSNPKIPLTTPSPSPTAAAA--P 531 Query: 408 QKTILSPASQRERLPRSAS 464 T LSP +++ P+SA+ Sbjct: 532 TTTTLSPPPTQQQPPQSAA 550 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 77,427,019 Number of Sequences: 219361 Number of extensions: 1286657 Number of successful extensions: 3272 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3175 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3270 length of database: 80,573,946 effective HSP length: 108 effective length of database: 56,882,958 effective search space used: 6655306086 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)