Clone Name | rbasd25m06 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | NHX7_ARATH (Q9LKW9) Sodium/hydrogen exchanger 7 (Na(+)/H(+) exch... | 30 | 1.9 | 2 | PIP2_YEAST (P52960) Peroxisome proliferation transcriptional reg... | 30 | 1.9 | 3 | ATP8_PISOC (P25004) ATP synthase protein 8 (EC 3.6.3.14) (ATPase... | 30 | 2.5 |
---|
>NHX7_ARATH (Q9LKW9) Sodium/hydrogen exchanger 7 (Na(+)/H(+) exchanger 7)| (NHE-7) (Protein SALT OVERLY SENSITIVE 1) Length = 1146 Score = 30.4 bits (67), Expect = 1.9 Identities = 13/28 (46%), Positives = 18/28 (64%) Frame = -1 Query: 338 PPTFCETIVHPKGEVVELIVMTAYKIGA 255 PP FCE + H K E ++L +T YK G+ Sbjct: 746 PPAFCEPLKHSKKEPMKLRGVTLYKEGS 773
>PIP2_YEAST (P52960) Peroxisome proliferation transcriptional regulator| (Oleate-activated transcription factor 2) Length = 996 Score = 30.4 bits (67), Expect = 1.9 Identities = 15/49 (30%), Positives = 22/49 (44%) Frame = -1 Query: 404 CKCLSLVTA*CLLGFRCDFSFSPPTFCETIVHPKGEVVELIVMTAYKIG 258 C C + T CLL C F FSP + P ++ L+++ IG Sbjct: 390 CACANENTISCLLYIWCAFVFSPTEGDFLLEQPSDVIINLVILIGTSIG 438
>ATP8_PISOC (P25004) ATP synthase protein 8 (EC 3.6.3.14) (ATPase subunit 8)| (A6L) Length = 55 Score = 30.0 bits (66), Expect = 2.5 Identities = 14/40 (35%), Positives = 23/40 (57%), Gaps = 2/40 (5%) Frame = +3 Query: 201 LAWFF--VVLLLMLLTSFNHRAYFIGCHDYQLNNFSFWMY 314 LAWFF +V+ ++L +F Y H +LN F+ W++ Sbjct: 15 LAWFFLFIVVTILLKINFPSTNYITVTHPQKLNIFNNWLW 54 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 60,144,886 Number of Sequences: 219361 Number of extensions: 1118792 Number of successful extensions: 2082 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2063 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2081 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2453576370 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)