| Clone Name | rbasd26a11 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | PA2GX_HUMAN (O15496) Group 10 secretory phospholipase A2 precurs... | 30 | 4.5 | 2 | MSH3_ARATH (O65607) DNA mismatch repair protein MSH3 (AtMsh3) | 29 | 10.0 |
|---|
>PA2GX_HUMAN (O15496) Group 10 secretory phospholipase A2 precursor (EC 3.1.1.4)| (Group X secretory phospholipase A2) (Phosphatidylcholine 2-acylhydrolase GX) (GX sPLA2) (sPLA2-X) Length = 155 Score = 30.0 bits (66), Expect = 4.5 Identities = 13/49 (26%), Positives = 25/49 (51%), Gaps = 1/49 (2%) Frame = +2 Query: 347 KEIVKYCTKG*CNTYHVC-KQVHSSRCSSPTHEITWQRINANIHCGP*E 490 ++ + +C C+ + C + + CS T +WQ +N ++ CGP E Sbjct: 68 RDAIDWC----CHGHDCCYTRAEEAGCSPKTERYSWQCVNQSVLCGPAE 112
>MSH3_ARATH (O65607) DNA mismatch repair protein MSH3 (AtMsh3)| Length = 1081 Score = 28.9 bits (63), Expect = 10.0 Identities = 12/26 (46%), Positives = 14/26 (53%) Frame = -1 Query: 128 ESEENGSSCCTTHQIKKMVHLAAQPI 51 E+ E G SC T H I M HL Q + Sbjct: 364 EAAEKGMSCLTVHTIMNMPHLTVQAL 389 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 77,858,080 Number of Sequences: 219361 Number of extensions: 1573293 Number of successful extensions: 2936 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2838 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2936 length of database: 80,573,946 effective HSP length: 105 effective length of database: 57,541,041 effective search space used: 4430660157 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)